Glypican 3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Glypican 3 Antibody [NBP1-85226] - Staining of human cell line Hep G2 shows localization to plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glypican 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glypican 3 Antibody - BSA Free (NBP1-85226) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Glypican 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry IHC reported in scientific literature (PMID: 24937430).
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC, WB reported in scientific literature (PMID: 24937430). Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Glypican 3 Protein (NBP1-85226PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%). Rat, Human reactivity reported in scientific literature (PMID: 24937430).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glypican 3 Antibody - BSA Free

• DGSX
• Glypican 3
• glypican proteoglycan 3
• glypican-3
• GPC3
• GTR2-2
• heparan sulphate proteoglycan
• Intestinal protein OCI-5
• MXR7
• OCI5
• OCI-5
• secreted glypican-3
• SGB
• SGBS
• SGBS1SDYS

Background

The Glypican 3 (GPC3) gene encodes for a member of the glypican-related integral membrane proteoglycan family (GRIPS). Two isoforms of the protein exist, isoform 1 at a length of 580 amino acids long and 65 kDA while isoform 2 is 526 amino acids long at 59 kDA. The protein encoded by GPC3 is thought to prevent the dipeptidyl peptidase activity of DPP4 and may participate in the suppression and regulation of growth in the predominately mesodermal tissues and organs. The GPC3 gene participates in the Wnt signaling pathway, metabolism, and visual phototransduction through interactions with genes FGF2, WNT3A, WNT7B, BCAN, and BGN. GPC3 has been researched in various diseases such as paine syndrome, horner's sundrome, liver cirrhosis, simpson-golabi-behmel syndrome, germ cell tumors, wilms tumors, complex regional pain syndrome, and hepatocellulcar carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glypican 3 Antibody (NBP1-85226)(1)

Publication using NBP1-85226

• Knelson EH, Gaviglio AL, Nee JC et al. Stromal heparan sulfate differentiates neuroblasts to suppress neuroblastoma growth. J Clin Invest 2014-07-01 [PMID: 24937430] (IF/IHC, WB, Human, Rat)

Bioinformatics

• Gene Symbol: GPC3