Glypican 4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Glypican 4 Antibody [NBP1-87697] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Glypican 4 Antibody [NBP1-87697] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glypican 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glypican 4 Protein (NBP1-87697PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glypican 4 Antibody

  • Glypican 4
  • glypican proteoglycan 4
  • glypican-4
  • GPC4
  • K-glypican
  • K-glypicandJ900E8.1 (glypican 4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-33197
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87565
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2607
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
AF2364
Species: Hu
Applications: WB, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
BPI
7468-BP
Species: Hu
NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF2918
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1759
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80641
Species: Hu
Applications: IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB

Publications for Glypican 4 Antibody (NBP1-87697) (0)

There are no publications for Glypican 4 Antibody (NBP1-87697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glypican 4 Antibody (NBP1-87697) (0)

There are no reviews for Glypican 4 Antibody (NBP1-87697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Glypican 4 Antibody (NBP1-87697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glypican 4 Products

Bioinformatics Tool for Glypican 4 Antibody (NBP1-87697)

Discover related pathways, diseases and genes to Glypican 4 Antibody (NBP1-87697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glypican 4 Antibody (NBP1-87697)

Discover more about diseases related to Glypican 4 Antibody (NBP1-87697).
 

Pathways for Glypican 4 Antibody (NBP1-87697)

View related products by pathway.

PTMs for Glypican 4 Antibody (NBP1-87697)

Learn more about PTMs related to Glypican 4 Antibody (NBP1-87697).

Blogs on Glypican 4

There are no specific blogs for Glypican 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glypican 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPC4
Entrez