Staining of human cell line CACO-2 shows localization to plasma membrane.
Staining of human testis shows strong membranous positivity in spermatocytes and spermatids.
Staining of human small intestine shows no membranous positivity in glandular cells as expected.
Staining of human fallopian tube shows no membranous positivity in glandular cells as expected.
Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
High glucose-induced premature senescent HRMECs exhibit diminished glycolysis. (A) Gene Set Enrichment Analysis for Glycolysis gene signature. Transcriptome data from bulk RNA sequencing of three biological replicates ...read more
Novus Biologicals Rabbit Glut3 Antibody - BSA Free (NBP1-89762) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Glut3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Western Blot Reported in scientific literature (PMID 25948295)
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Glut3 Antibody - BSA Free
FLJ90380
Glut3
GLUT-3
GLUT3Glucose transporter type 3, brain
SLC2A3
solute carrier family 2 (facilitated glucose transporter), member 3
solute carrier family 2, facilitated glucose transporter member 3
Background
Glucose is the major source of our energy and there are numerous isoforms of the glucose transporter in mammals, including Glut1, Glut2, Glut3, Glut4, Glut5, Glut6, Glut7, Glut8 and Glut9. The Glut5 gene located on the short arm of human chromosome 1 encodes a 501-amino acid facilitative glucose transporter. Glut5 mRNA is highly expressed in small intestine and to a lesser extent in kidney, skeletal muscle and adipose tissue. Glut5 plays a critical role in fructose absorption in the small intestine and its expression is highly induced when exposed to a fructose-enriched diet. Glut5 transporter expressed in human skeletal muscle is specifically localized to the plasma membrane, where it participates in regulating hexose transfer across the sarcolemma. Glut8, a novel glucose transporter-like protein, exhibits significant sequence similarity with the other members of sugar transporter family. Glut8 comprises 12 putative membrane-spanning helices and several conserved motifs, which are important for transport activity. In human tissues, Glut8 is predominantly expressed in testis and, to a lesser extent, in most other tissues including skeletal muscle, heart, small intestine and brain. In addition, the Glut8 glucose transport facilitator has a hormonally regulated testicular function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Glut3 Antibody - BSA Free and receive a gift card or discount.