Glucose Transporter GLUT8 Antibody


Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Glucose Transporter GLUT8 Antibody Summary

Synthetic peptides corresponding to SLC2A8(solute carrier family 2 (facilitated glucose transporter), member 8) The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC2A8 and was validated on Western blot.
Positive Control
Glucose Transporter GLUT8 Lysate (NBP2-65282)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glucose Transporter GLUT8 Antibody

  • GLUT-8
  • GLUT8solute carrier family 2 (facilitated glucose transporter) member 8
  • GLUTX1facilitated glucose transporter member 8
  • solute carrier family 2 (facilitated glucose transporter), member 8


SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB

Publications for Glucose Transporter GLUT8 Antibody (NBP1-59812) (0)

There are no publications for Glucose Transporter GLUT8 Antibody (NBP1-59812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose Transporter GLUT8 Antibody (NBP1-59812) (0)

There are no reviews for Glucose Transporter GLUT8 Antibody (NBP1-59812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucose Transporter GLUT8 Antibody (NBP1-59812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Glucose Transporter GLUT8 Antibody (NBP1-59812)

Discover related pathways, diseases and genes to Glucose Transporter GLUT8 Antibody (NBP1-59812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose Transporter GLUT8 Antibody (NBP1-59812)

Discover more about diseases related to Glucose Transporter GLUT8 Antibody (NBP1-59812).

Pathways for Glucose Transporter GLUT8 Antibody (NBP1-59812)

View related products by pathway.

PTMs for Glucose Transporter GLUT8 Antibody (NBP1-59812)

Learn more about PTMs related to Glucose Transporter GLUT8 Antibody (NBP1-59812).

Blogs on Glucose Transporter GLUT8

There are no specific blogs for Glucose Transporter GLUT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glucose Transporter GLUT8 Antibody and receive a gift card or discount.


Gene Symbol SLC2A8