Western Blot: MCT2 Antibody [NBP1-87846] - Analysis in control (vector only transfected HEK293T lysate) and SLC16A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Staining of human stomach shows strong membranous positivity in glandular cells.
Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Novus Biologicals Rabbit MCT2 Antibody - BSA Free (NBP1-87846) is a polyclonal antibody validated for use in IHC and WB. Anti-MCT2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for MCT2 Antibody - BSA Free
MCT 2
MCT2
MCT2solute carrier family 16 (monocarboxylic acid transporters), member 7
monocarboxylate transporter 2
SLC16A7
Solute carrier family 16 member 7
solute carrier family 16, member 7 (monocarboxylic acid transporter 2)
Background
Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family 16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. MCT2 is a high affinity transporter that catalyzes the rapid transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate across the plasma membrane.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MCT2 Antibody - BSA Free and receive a gift card or discount.