GluR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutamate Receptor 1 Antibody [NBP2-33996] - Staining of human hippocampus shows moderate membranous and cytoplasmic positivity in fraction of neuronal cells. Neuropil was distinctly stained.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GluR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GluR1 Antibody - BSA Free (NBP2-33996) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRIA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GluR1 Protein (NBP2-33996PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GluR1 Antibody - BSA Free

• AMPA 1
• AMPA-selective glutamate receptor 1
• GluA1
• GLUH1
• GluR1
• gluR-1
• GLUR1gluR-A
• GLURA
• GluR-A
• gluR-K1
• glutamate receptor 1
• Glutamate receptor ionotropic, AMPA 1
• glutamate receptor, ionotropic, AMPA 1
• GRIA1
• HBGR1
• MGC133252

Background

Glutamate Receptor 1 belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for Glutamate Receptor 1. Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRIA1
• Uniprot:
  • P42261(Human)