EARS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EARS2 Antibody [NBP1-91856] - Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Immunohistochemistry-Paraffin: EARS2 Antibody [NBP1-91856] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
Specificity
Specificity of human EARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EARS2 Protein (NBP1-91856PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EARS2 Antibody

  • EC 6.1.1.17
  • gluRS
  • Glutamate--tRNA ligase
  • glutamyl-tRNA synthetase 2, mitochondrial (putative)
  • KIAA1970glutamate tRNA ligase 2, mitochondrial
  • MSE1
  • probable glutamyl-tRNA synthetase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24940
Species: Hu, Ye
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-171
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61856
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-66402
Species: Hu
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for EARS2 Antibody (NBP1-91856) (0)

There are no publications for EARS2 Antibody (NBP1-91856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EARS2 Antibody (NBP1-91856) (0)

There are no reviews for EARS2 Antibody (NBP1-91856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EARS2 Antibody (NBP1-91856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EARS2 Antibody (NBP1-91856)

Discover related pathways, diseases and genes to EARS2 Antibody (NBP1-91856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EARS2 Antibody (NBP1-91856)

Discover more about diseases related to EARS2 Antibody (NBP1-91856).
 

Pathways for EARS2 Antibody (NBP1-91856)

View related products by pathway.

Research Areas for EARS2 Antibody (NBP1-91856)

Find related products by research area.

Blogs on EARS2

There are no specific blogs for EARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EARS2