NDOR1 Antibody

Images

 
Western Blot: NDOR1 Antibody [NBP1-88790] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: NDOR1 Antibody [NBP1-88790] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Western Blot: NDOR1 Antibody [NBP1-88790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDOR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDOR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDOR1 Protein (NBP1-88790PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDOR1 Antibody

  • bA350O14.9
  • EC 1.6
  • MGC138148
  • NADPH dependent diflavin oxidoreductase 1
  • NADPH-dependent diflavin oxidoreductase 1
  • NADPH-dependent FMN and FAD containing oxidoreductase
  • NADPH-dependent FMN and FAD-containing oxidoreductase
  • Novel reductase 1
  • NR1NADPH dependent FMN and FAD containing oxidoreductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67737
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-89765
Species: Hu
Applications: IHC, IHC-P
NB300-124
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB300-107
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-94573
Species: Hu, Mu, Rt
Applications: WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-02312
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB

Publications for NDOR1 Antibody (NBP1-88790) (0)

There are no publications for NDOR1 Antibody (NBP1-88790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDOR1 Antibody (NBP1-88790) (0)

There are no reviews for NDOR1 Antibody (NBP1-88790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDOR1 Antibody (NBP1-88790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDOR1 Products

Bioinformatics Tool for NDOR1 Antibody (NBP1-88790)

Discover related pathways, diseases and genes to NDOR1 Antibody (NBP1-88790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDOR1 Antibody (NBP1-88790)

Discover more about diseases related to NDOR1 Antibody (NBP1-88790).
 

Pathways for NDOR1 Antibody (NBP1-88790)

View related products by pathway.

PTMs for NDOR1 Antibody (NBP1-88790)

Learn more about PTMs related to NDOR1 Antibody (NBP1-88790).

Blogs on NDOR1

There are no specific blogs for NDOR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDOR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDOR1