GFR alpha-1/GDNF R alpha-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human colon shows moderate cytoplasmic positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GFR alpha-1/GDNF R alpha-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GFRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GFR alpha-1/GDNF R alpha-1 Antibody

  • DKFZp313E1012
  • DKFZp686J0156
  • GDNF family receptor alpha 1
  • GDNF family receptor alpha-1
  • GDNF R alpha-1
  • GDNF receptor alpha-1
  • GDNFRAGFR-ALPHA-1
  • GDNFR-alpha-1
  • GDNFRMGC23045
  • GFR alpha1
  • GFR alpha-1
  • GFRA1
  • GFRa-1
  • GFR-alpha-1
  • Glial cell line-derived neurotrophic factor receptor alpha
  • GPI-linked anchor protein
  • PI-linked cell-surface accessory protein
  • RET ligand 1
  • RET1L
  • RETL1FLJ10561
  • TGF-beta related neurotrophic factor receptor 1
  • TGF-beta-related neurotrophic factor receptor 1
  • TRNR1FLJ31546

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
AF429
Species: Hu, Mu
Applications: WB, IHC, Block
AF1085
Species: Mu
Applications: WB, IHC, Neut
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB2388
Species: Hu
Applications: WB, IHC
AF2645
Species: Mu
Applications: WB, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14045
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045) (0)

There are no publications for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045) (0)

There are no reviews for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFR alpha-1/GDNF R alpha-1 Products

Bioinformatics Tool for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045)

Discover related pathways, diseases and genes to GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045)

Discover more about diseases related to GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045).
 

Pathways for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045)

View related products by pathway.

PTMs for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045)

Learn more about PTMs related to GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045).
 

Research Areas for GFR alpha-1/GDNF R alpha-1 Antibody (NBP2-14045)

Find related products by research area.

Blogs on GFR alpha-1/GDNF R alpha-1

There are no specific blogs for GFR alpha-1/GDNF R alpha-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFR alpha-1/GDNF R alpha-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GFRA1
Entrez