RAPGEF5 Antibody


Western Blot: RAPGEF5 Antibody [NBP2-57362] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: RAPGEF5 Antibody [NBP2-57362] - Staining of human cell line PC-3 shows localization to nucleoplasm & nuclear bodies.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

RAPGEF5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLD
Specificity of human RAPGEF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAPGEF5 Recombinant Protein Antigen (NBP2-57362PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RAPGEF5 Antibody

  • Guanine nucleotide exchange factor for Rap1
  • KIAA0277M-Ras-regulated GEF
  • M-Ras-regulated Rap GEF
  • MR-GEFrap guanine nucleotide exchange factor 5
  • Rap guanine nucleotide exchange factor (GEF) 5
  • Related to Epac
  • Repac


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RAPGEF5 Antibody (NBP2-57362) (0)

There are no publications for RAPGEF5 Antibody (NBP2-57362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAPGEF5 Antibody (NBP2-57362) (0)

There are no reviews for RAPGEF5 Antibody (NBP2-57362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAPGEF5 Antibody (NBP2-57362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RAPGEF5 Products

Bioinformatics Tool for RAPGEF5 Antibody (NBP2-57362)

Discover related pathways, diseases and genes to RAPGEF5 Antibody (NBP2-57362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAPGEF5 Antibody (NBP2-57362)

Discover more about diseases related to RAPGEF5 Antibody (NBP2-57362).

Pathways for RAPGEF5 Antibody (NBP2-57362)

View related products by pathway.

Research Areas for RAPGEF5 Antibody (NBP2-57362)

Find related products by research area.

Blogs on RAPGEF5

There are no specific blogs for RAPGEF5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAPGEF5 Antibody and receive a gift card or discount.


Gene Symbol RAPGEF5