| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Endotoxin, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 131-230 of Human GFAP Source: Wheat Germ (in vitro) Amino Acid Sequence: TANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | GFAP |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 51 mM Tris-HCl (pH 8), 10 mM reduced Glutathione, in the elution buffer |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for GFAP Partial Recombinant Protein (H00002670-Q01)Find related products by research area.
|
|
Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera... Read full blog post. |
|
Astrocytes: Diversity in type and function By Michalina Hanzel, PhDAstrocytes are a type of macroglia found in the central nervous system that regulate a vast array of essential brain functions, ranging from synaptogenesis, ion homeostasis and maintenance of t... Read full blog post. |
|
Role of GFAP in astrocytes: Lessons from induced pluripotent stem cells in Alexander disease patients By Michalina Hanzel, PhDAlexander disease is a progressive and fatal neurological disease with phenotypes ranging from myelination abnormalities, gait ataxia and megalencephaly to predisposition to seizures. It is an ... Read full blog post. |
|
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
|
Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ... Read full blog post. |
|
Beta Tubulin III and neurogenesis Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr... Read full blog post. |
|
The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2 Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain. Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa). The importance of t... Read full blog post. |
|
Synapsin I: Implicated in synaptic activity across a diverse range of studies Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal. Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i... Read full blog post. |
|
Glial Fibrillary Acidic Protein (GFAP), The Most Popular Astrocyte Marker GFAP, a class-III intermediate filament, is a 50kDa protein which is found in the mature and developing astrocytes in the CNS, non-myelinating Schwann cells in the PNS, enteric glial cells (enteric nervous system/ENS), ependymal cells, and radial g... Read full blog post. |
|
Nestin: Investigating the Link Between New Brain Cells and Depression Clinical depression (also known as major depressive disorder or MDD) affects many people, but the biological processes that cause it (and are influenced by its treatments) are not well understood. Adult neurogenesis is a newly emerging field that coul... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GFAP |