Gemin 3 Antibody

Images

 
Western Blot: Gemin 3 Antibody [NBP1-84058] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Gemin 3 Antibody [NBP1-84058] - Staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: Gemin 3 Antibody [NBP1-84058] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gemin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Gemin 3 Protein (NBP1-84058PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gemin 3 Antibody

  • Component of gems 3
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
  • DEAD box protein 20
  • DEAD box protein DP 103
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD
  • DKFZp434H052
  • DP103DEAD-box protein DP103
  • EC 3.6.4.13
  • Gemin-3
  • GEMIN3gemin-3
  • probable ATP-dependent RNA helicase DDX20
  • SMN-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NB100-61049
Species: Hu, Po, SyHa
Applications: WB, IP
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80931
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-82075
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-87028
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Gemin 3 Antibody (NBP1-84058) (0)

There are no publications for Gemin 3 Antibody (NBP1-84058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gemin 3 Antibody (NBP1-84058) (0)

There are no reviews for Gemin 3 Antibody (NBP1-84058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gemin 3 Antibody (NBP1-84058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gemin 3 Products

Bioinformatics Tool for Gemin 3 Antibody (NBP1-84058)

Discover related pathways, diseases and genes to Gemin 3 Antibody (NBP1-84058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gemin 3 Antibody (NBP1-84058)

Discover more about diseases related to Gemin 3 Antibody (NBP1-84058).
 

Pathways for Gemin 3 Antibody (NBP1-84058)

View related products by pathway.

PTMs for Gemin 3 Antibody (NBP1-84058)

Learn more about PTMs related to Gemin 3 Antibody (NBP1-84058).
 

Research Areas for Gemin 3 Antibody (NBP1-84058)

Find related products by research area.

Blogs on Gemin 3

There are no specific blogs for Gemin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gemin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX20