GDF-6/BMP-13 Antibody

Immunocytochemistry/Immunofluorescence: GDF-6/BMP-13 Antibody [NBP1-91934] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GDF-6/BMP-13 Antibody [NBP1-91934] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GDF-6/BMP-13 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLF
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GDF6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
• Application Notes: Use in IP reported in scientific literature (PMID:33147457) For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  GDF-6/BMP-13 Protein (NBP1-91934PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GDF-6/BMP-13 Antibody

• BMP13
• BMP-13
• CDMP2
• GDF16
• GDF6
• GDF-6
• growth differentiation factor 6
• Growth/differentiation factor 16
• growth/differentiation factor 6
• KFS
• KFS1
• KFSL
• MCOP4
• MCOPCB6
• MGC158100
• MGC158101
• SCDO4
• SGM1

Background

GDF6 encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation. [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GDF-6/BMP-13 Antibody (NBP1-91934)(2)

Publications using NBP1-91934

• Jayabal P, Zhou F, Lei X Et Al. NELL2-cdc42 signaling regulates BAF complexes and Ewing sarcoma cell growth Cell reports 2021-07-06 [PMID: 34233189] (WB)
• Zhou F, Elzi DJ, Jayabal P et al. GDF6-CD99 Signaling Regulates Src and Ewing Sarcoma Growth Cell Rep 2020-11-03 [PMID: 33147457] (IP, Human)
  
  Details:
  Several human cell lines transfected with lentivirus containing GDF6 underwent immunoprecipitation.

Bioinformatics

• Gene Symbol: GDF6