GDF-6/BMP-13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GDF-6/BMP-13 Antibody [NBP1-91934] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GDF-6/BMP-13 Antibody [NBP1-91934] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDF-6/BMP-13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLF
Specificity
Specificity of human GDF-6/BMP-13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
Application Notes
Use in IP reported in scientific literature (PMID:33147457) For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
GDF-6/BMP-13 Protein (NBP1-91934PEP)
Publications
Read Publication using
NBP1-91934 in the following applications:

  • IP
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDF-6/BMP-13 Antibody

  • BMP13
  • BMP-13
  • CDMP2
  • GDF16
  • GDF6
  • GDF-6
  • growth differentiation factor 6
  • Growth/differentiation factor 16
  • growth/differentiation factor 6
  • KFS
  • KFS1
  • KFSL
  • MCOP4
  • MCOPCB6
  • MGC158100
  • MGC158101
  • SCDO4
  • SGM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1060
Species: Mu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det)
615-BMC/CF
Species: Hu
MAB505
Species: Hu, Mu
Applications: WB
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00030062-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56443
Species: Hu, Mu, Rt
Applications: WB
NBP1-84476
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF958
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for GDF-6/BMP-13 Antibody (NBP1-91934)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GDF-6/BMP-13 Antibody (NBP1-91934) (0)

There are no reviews for GDF-6/BMP-13 Antibody (NBP1-91934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GDF-6/BMP-13 Antibody (NBP1-91934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GDF-6/BMP-13 Products

Bioinformatics Tool for GDF-6/BMP-13 Antibody (NBP1-91934)

Discover related pathways, diseases and genes to GDF-6/BMP-13 Antibody (NBP1-91934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-6/BMP-13 Antibody (NBP1-91934)

Discover more about diseases related to GDF-6/BMP-13 Antibody (NBP1-91934).
 

Pathways for GDF-6/BMP-13 Antibody (NBP1-91934)

View related products by pathway.

PTMs for GDF-6/BMP-13 Antibody (NBP1-91934)

Learn more about PTMs related to GDF-6/BMP-13 Antibody (NBP1-91934).
 

Research Areas for GDF-6/BMP-13 Antibody (NBP1-91934)

Find related products by research area.

Blogs on GDF-6/BMP-13

There are no specific blogs for GDF-6/BMP-13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-6/BMP-13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF6