Musculin Antibody (1D1)

Western Blot: Musculin Antibody (1D1) [H00009242-M01] - Detection against Immunogen (35.2 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Musculin Antibody (1D1) Summary

• Immunogen: MSC (NP_005089.1, 103 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRP
• Specificity: MSC - musculin (activated B-cell factor-1) (1D1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MSC
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Musculin Antibody (1D1)

• ABF1
• ABF-1activated B-cell factor 1, homolog of mouse musculin
• Activated B-cell factor 1
• BHLHA22
• bHLHa22activated B-cell factor-1
• Class A basic helix-loop-helix protein 22
• musculin (activated B-cell factor-1)
• musculin
• MYOR

Background

The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Musculin Antibody (H00009242-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Samuel Jones WB Human 01/02/2022

Summary

• Application: Western Blot
• Sample Tested: Gastric tissue
• Species: Human
• Lot: 1D1

Bioinformatics

• Gene Symbol: MSC
• Entrez:
  • 9242(Human)
• Uniprot:
  • NP_005089(Human)