GDF-11/BMP-11 Antibody (4F7) Summary
Immunogen |
GDF11 (NP_005802, 310 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Specificity |
GDF11 (4F7) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GDF11 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GDF-11/BMP-11 Antibody (4F7)
Background
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Block, KO, WB
Species: Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for GDF-11/BMP-11 Antibody (H00010220-M06) (0)
There are no publications for GDF-11/BMP-11 Antibody (H00010220-M06).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GDF-11/BMP-11 Antibody (H00010220-M06) (0)
There are no reviews for GDF-11/BMP-11 Antibody (H00010220-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GDF-11/BMP-11 Antibody (H00010220-M06) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GDF-11/BMP-11 Products
Diseases for GDF-11/BMP-11 Antibody (H00010220-M06)
Discover more about diseases related to GDF-11/BMP-11 Antibody (H00010220-M06).
| | Pathways for GDF-11/BMP-11 Antibody (H00010220-M06)
View related products by pathway.
|
PTMs for GDF-11/BMP-11 Antibody (H00010220-M06)
Learn more about PTMs related to GDF-11/BMP-11 Antibody (H00010220-M06).
| | Research Areas for GDF-11/BMP-11 Antibody (H00010220-M06)
Find related products by research area.
|
Blogs on GDF-11/BMP-11