GCDH Antibody


Western Blot: GCDH Antibody [NBP2-48549] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: GCDH Antibody [NBP2-48549] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining in human liver and testis tissues. Corresponding GCDH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human testis shows weak granular cytoplasmic positivity.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GCDH Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGV
Specificity of human GCDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GCDH Recombinant Protein Antigen (NBP2-48549PEP)

Reactivity Notes

Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GCDH Antibody

  • ACAD5
  • EC 1.3.99
  • EC
  • GCD
  • glutaryl-CoA dehydrogenase
  • glutaryl-CoA dehydrogenase, mitochondrial
  • glutaryl-Coenzyme A dehydrogenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ye
Applications: WB

Publications for GCDH Antibody (NBP2-48549) (0)

There are no publications for GCDH Antibody (NBP2-48549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCDH Antibody (NBP2-48549) (0)

There are no reviews for GCDH Antibody (NBP2-48549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCDH Antibody (NBP2-48549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GCDH Antibody (NBP2-48549)

Discover related pathways, diseases and genes to GCDH Antibody (NBP2-48549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCDH Antibody (NBP2-48549)

Discover more about diseases related to GCDH Antibody (NBP2-48549).

Pathways for GCDH Antibody (NBP2-48549)

View related products by pathway.

PTMs for GCDH Antibody (NBP2-48549)

Learn more about PTMs related to GCDH Antibody (NBP2-48549).

Research Areas for GCDH Antibody (NBP2-48549)

Find related products by research area.

Blogs on GCDH

There are no specific blogs for GCDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GCDH Antibody and receive a gift card or discount.


Gene Symbol GCDH