GCDH Antibody

Images

 
Independent Antibodies: Western Blot: GCDH Antibody [NBP2-48549] - Analysis using Anti-GCDH antibody NBP2-48549 (A) shows similar pattern to independent antibody NBP2-48907 (B).
Immunocytochemistry/ Immunofluorescence: GCDH Antibody [NBP2-48549] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Independent Antibodies: Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human kidney, liver, pancreas and testis using Anti-GCDH antibody NBP2-48549 (A) shows similar protein distribution ...read more
Western Blot: GCDH Antibody [NBP2-48549] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human testis shows weak granular cytoplasmic positivity.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining in human liver and testis tissues. Corresponding GCDH RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCDH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGV
Specificity
Specificity of human GCDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCDH Antibody

  • ACAD5
  • EC 1.3.99
  • EC 1.3.99.7
  • GCD
  • glutaryl-CoA dehydrogenase
  • glutaryl-CoA dehydrogenase, mitochondrial
  • glutaryl-Coenzyme A dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Rt, Ca, Kg, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55789
Species: Hu
Applications: ICC/IF
7954-GM/CF
Species: Hu
NBP1-88606
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP2-30578
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC

Publications for GCDH Antibody (NBP2-48549) (0)

There are no publications for GCDH Antibody (NBP2-48549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCDH Antibody (NBP2-48549) (0)

There are no reviews for GCDH Antibody (NBP2-48549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCDH Antibody (NBP2-48549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCDH Products

Bioinformatics Tool for GCDH Antibody (NBP2-48549)

Discover related pathways, diseases and genes to GCDH Antibody (NBP2-48549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCDH Antibody (NBP2-48549)

Discover more about diseases related to GCDH Antibody (NBP2-48549).
 

Pathways for GCDH Antibody (NBP2-48549)

View related products by pathway.

PTMs for GCDH Antibody (NBP2-48549)

Learn more about PTMs related to GCDH Antibody (NBP2-48549).
 

Research Areas for GCDH Antibody (NBP2-48549)

Find related products by research area.

Blogs on GCDH

There are no specific blogs for GCDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCDH