ACADS Antibody

Images

 
Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry: ACADS Antibody [NBP1-89290] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACADS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACADS Protein (NBP1-89290PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACADS Antibody

  • ACAD3
  • acyl-CoA dehydrogenase, C-2 to C-3 short chain
  • acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain
  • Butyryl-CoA dehydrogenase
  • EC 1.3.99
  • EC 1.3.99.2
  • mitochondrial short-chain specific acyl-CoA dehydrogenase
  • SCADshort-chain acyl-CoA dehydrogenase
  • short-chain specific acyl-CoA dehydrogenase, mitochondrial
  • unsaturated acyl-CoA reductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ACADS Antibody (NBP1-89290) (0)

There are no publications for ACADS Antibody (NBP1-89290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADS Antibody (NBP1-89290) (0)

There are no reviews for ACADS Antibody (NBP1-89290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACADS Antibody (NBP1-89290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACADS Products

Bioinformatics Tool for ACADS Antibody (NBP1-89290)

Discover related pathways, diseases and genes to ACADS Antibody (NBP1-89290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADS Antibody (NBP1-89290)

Discover more about diseases related to ACADS Antibody (NBP1-89290).
 

Pathways for ACADS Antibody (NBP1-89290)

View related products by pathway.

PTMs for ACADS Antibody (NBP1-89290)

Learn more about PTMs related to ACADS Antibody (NBP1-89290).

Blogs on ACADS

There are no specific blogs for ACADS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADS