ETFDH Antibody

Images

 
Western Blot: ETFDH Antibody [NBP1-83950] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining in human duodenum and pancreas tissues using anti-ETFDH antibody. Corresponding ETFDH RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ETFDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMN
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETFDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ETFDH Protein (NBP1-83950PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ETFDH Antibody

  • electron-transferring-flavoprotein dehydrogenaseEC 1.5.5.1
  • ETFQO
  • ETF-QO
  • MADD
  • mitochondrial

Background

Electron-transferring-flavoprotein dehydrogenase in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The protein is synthesized as a 67-kDa precursor which is targeted to mitochondria and processed in a single step to a 64-kDa mature form located in the mitochondrial membrane. Deficiency in electron-transferring-flavoprotein dehydrogenase have been demonstrated in some patients with type II glutaricacidemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ETFDH Antibody (NBP1-83950) (0)

There are no publications for ETFDH Antibody (NBP1-83950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFDH Antibody (NBP1-83950) (0)

There are no reviews for ETFDH Antibody (NBP1-83950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETFDH Antibody (NBP1-83950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ETFDH Products

Array NBP1-83950

Research Areas for ETFDH Antibody (NBP1-83950)

Find related products by research area.

Blogs on ETFDH

There are no specific blogs for ETFDH, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETFDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETFDH