ETFDH Antibody

Images

 
Western Blot: ETFDH Antibody [NBP1-83950] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining in human duodenum and pancreas tissues using anti-ETFDH antibody. Corresponding ETFDH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETFDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMN
Specificity
Specificity of human ETFDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETFDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ETFDH Protein (NBP1-83950PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ETFDH Antibody

  • electron-transferring-flavoprotein dehydrogenaseEC 1.5.5.1
  • ETFQO
  • ETF-QO
  • MADD
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55789
Species: Hu
Applications: ICC/IF
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
MAB2476
Species: Hu
Applications: WB, IHC
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84854
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24508
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-16407
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2727
Species: Hu
Applications: WB, Simple Western, ICC

Publications for ETFDH Antibody (NBP1-83950) (0)

There are no publications for ETFDH Antibody (NBP1-83950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFDH Antibody (NBP1-83950) (0)

There are no reviews for ETFDH Antibody (NBP1-83950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETFDH Antibody (NBP1-83950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ETFDH Antibody (NBP1-83950)

Discover related pathways, diseases and genes to ETFDH Antibody (NBP1-83950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETFDH Antibody (NBP1-83950)

Discover more about diseases related to ETFDH Antibody (NBP1-83950).
 

Pathways for ETFDH Antibody (NBP1-83950)

View related products by pathway.

PTMs for ETFDH Antibody (NBP1-83950)

Learn more about PTMs related to ETFDH Antibody (NBP1-83950).

Blogs on ETFDH

There are no specific blogs for ETFDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETFDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETFDH