GATA-2 Antibody

Images

 
Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line SH-SY5Y.
Immunocytochemistry/ Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line HELA.
Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/ml of HEL lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GATA-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:100
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24583263).

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GATA-2 Protein (NBP1-82581PEP)
Publications
Read Publications using
NBP1-82581 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24583263)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GATA-2 Antibody

  • endothelial transcription factor GATA-2
  • FLJ45948
  • GATA binding protein 2
  • GATA2
  • GATA-2
  • GATA-binding protein 2NFE1B
  • MGC2306

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-57016
Species: Hu
Applications: WB
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NBP1-82581
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GATA-2 Antibody (NBP1-82581)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 5 applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
IHC-Fr
(1)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-82581 Applications Species
Shi X, Richard J, Zirbes KM et al. Cooperative interaction of Etv2 and Gata2 regulates the development of endothelial and hematopoietic lineages. Dev. Biol. 2014 Mar 03 [PMID: 24583263] (IHC-Fr, Mouse) IHC-Fr Mouse
Chiang Yan Ting, Wang Kendric, Fazli Ladan et al. GATA2 as a potential metastasis-driving gene in prostate cancer. Oncotarget. 2014 Jan 30 [PMID: 24448395] (IHC, Human) IHC Human
Chiang YT. Identification of metastasis-driving genes as potential therapeutic targets/biomarkers for metastatic prostate cancer (Thesis Supervisor - Dr. Yuzhuo Wang, BC Cancer Agency Research Centre, Canada) Thesis 2015 (IHC-P, WB, ICC/IF, Human) IHC-P, WB, ICC/IF Human

Reviews for GATA-2 Antibody (NBP1-82581) (0)

There are no reviews for GATA-2 Antibody (NBP1-82581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GATA-2 Antibody (NBP1-82581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATA-2 Products

Bioinformatics Tool for GATA-2 Antibody (NBP1-82581)

Discover related pathways, diseases and genes to GATA-2 Antibody (NBP1-82581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-2 Antibody (NBP1-82581)

Discover more about diseases related to GATA-2 Antibody (NBP1-82581).
 

Pathways for GATA-2 Antibody (NBP1-82581)

View related products by pathway.

PTMs for GATA-2 Antibody (NBP1-82581)

Learn more about PTMs related to GATA-2 Antibody (NBP1-82581).

Blogs on GATA-2

There are no specific blogs for GATA-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATA-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA2
Entrez
Uniprot