SCLY Antibody


Western Blot: SCLY Antibody [NBP2-48693] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue
Immunocytochemistry/ Immunofluorescence: SCLY Antibody [NBP2-48693] - Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SCLY Antibody [NBP2-48693] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SCLY Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Specificity of human SCLY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCLY Recombinant Protein Antigen (NBP2-48693PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SCLY Antibody

  • EC
  • selenocysteine lyase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SCLY Antibody (NBP2-48693) (0)

There are no publications for SCLY Antibody (NBP2-48693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCLY Antibody (NBP2-48693) (0)

There are no reviews for SCLY Antibody (NBP2-48693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCLY Antibody (NBP2-48693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SCLY Products

Bioinformatics Tool for SCLY Antibody (NBP2-48693)

Discover related pathways, diseases and genes to SCLY Antibody (NBP2-48693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCLY Antibody (NBP2-48693)

Discover more about diseases related to SCLY Antibody (NBP2-48693).

Pathways for SCLY Antibody (NBP2-48693)

View related products by pathway.

PTMs for SCLY Antibody (NBP2-48693)

Learn more about PTMs related to SCLY Antibody (NBP2-48693).

Blogs on SCLY

There are no specific blogs for SCLY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SCLY Antibody and receive a gift card or discount.


Gene Symbol SCLY