ZFPM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZFPM1 Antibody [NBP2-47572] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemistry-Paraffin: ZFPM1 Antibody [NBP2-47572] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: ZFPM1 Antibody [NBP2-47572] - Staining of human cervix, uterine shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ZFPM1 Antibody [NBP2-47572] - Staining in human stomach and cervix, uterine tissues using anti-ZFPM1 antibody. Corresponding ZFPM1 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ZFPM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGLAPTPSPGLDRKALAEATNGEARAAPQNGGSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFPM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFPM1 Protein (NBP2-47572PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFPM1 Antibody

  • FOG-1
  • FOG1ZNF408
  • FOGfriend of GATA-1
  • Friend of GATA 1
  • Friend of GATA protein 1
  • ZFN89A
  • Zinc finger protein 89A
  • Zinc finger protein multitype 1
  • zinc finger protein ZFPM1
  • zinc finger protein, multitype 1
  • ZNF89A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-32895
Species: Hu, Mu, Rt
Applications: WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-87992
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-82580
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NB400-111
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-75453
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, IP, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZFPM1 Antibody (NBP2-47572) (0)

There are no publications for ZFPM1 Antibody (NBP2-47572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFPM1 Antibody (NBP2-47572) (0)

There are no reviews for ZFPM1 Antibody (NBP2-47572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZFPM1 Antibody (NBP2-47572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFPM1 Products

Array NBP2-47572

Bioinformatics Tool for ZFPM1 Antibody (NBP2-47572)

Discover related pathways, diseases and genes to ZFPM1 Antibody (NBP2-47572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFPM1 Antibody (NBP2-47572)

Discover more about diseases related to ZFPM1 Antibody (NBP2-47572).
 

Pathways for ZFPM1 Antibody (NBP2-47572)

View related products by pathway.

PTMs for ZFPM1 Antibody (NBP2-47572)

Learn more about PTMs related to ZFPM1 Antibody (NBP2-47572).
 

Research Areas for ZFPM1 Antibody (NBP2-47572)

Find related products by research area.

Blogs on ZFPM1

There are no specific blogs for ZFPM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFPM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFPM1