GARS Antibody

Images

 
Western Blot: GARS Antibody [NBP1-85534] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: GARS Antibody [NBP1-85534] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: GARS Antibody [NBP1-85534] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GARS Protein (NBP1-85534PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GARS Antibody

  • AP-4-A synthetase
  • Charcot-Marie-Tooth neuropathy 2D
  • Charcot-Marie-Tooth neuropathy, neuronal type, D
  • Diadenosine tetraphosphate synthetase
  • DSMAV
  • glycine tRNA ligase
  • Glycine--tRNA ligase
  • glycyl-tRNA synthetase
  • GlyRSEC 6.1.1.14
  • HMN5
  • SMAD1CMT2D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2097
Species: Hu
Applications: WB, ChIP, ICC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2250
Species: Hu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF7215
Species: Hu, Mu
Applications: IHC, ICC
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for GARS Antibody (NBP1-85534) (0)

There are no publications for GARS Antibody (NBP1-85534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GARS Antibody (NBP1-85534) (0)

There are no reviews for GARS Antibody (NBP1-85534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GARS Antibody (NBP1-85534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GARS Products

Bioinformatics Tool for GARS Antibody (NBP1-85534)

Discover related pathways, diseases and genes to GARS Antibody (NBP1-85534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GARS Antibody (NBP1-85534)

Discover more about diseases related to GARS Antibody (NBP1-85534).
 

Pathways for GARS Antibody (NBP1-85534)

View related products by pathway.

PTMs for GARS Antibody (NBP1-85534)

Learn more about PTMs related to GARS Antibody (NBP1-85534).
 

Research Areas for GARS Antibody (NBP1-85534)

Find related products by research area.

Blogs on GARS

There are no specific blogs for GARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GARS