Galectin-9 Antibody - BSA Free

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Analysis in human rectum and skeletal muscle tissues using NBP2-33484 antibody. Corresponding Galectin-9 RNA-seq data are presented for the same tissues.

Western Blot: Galectin-9 Antibody [NBP2-33484] - Analysis in human cell line THP-1.

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Galectin-9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Galectin-9 Antibody - BSA Free (NBP2-33484) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGALS9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Galectin-9 Protein (NBP2-33484PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Galectin-9 Antibody - BSA Free

• Ecalectin
• GAL9
• gal-9
• galectin 9
• Galectin9
• Galectin-9
• HUAT
• lectin, galactoside-binding, soluble, 9
• LGALS9
• LGALS9A
• MGC117375
• MGC125973
• MGC125974
• Tumor antigen HOM-HD-21
• urate transporter/channel protein

Background

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin 9 is an S-type lectin and an eosinophil chemoattractant (ECA) produced by antigen-activated T cells. Galectin 9 is involved in apoptosis, is thought to be a prognostic factor for breast cancer and is also overexpressed in Hodgkin's disease tissue. The protein has N- and C- terminal carbohydrate-binding domains connected by a link peptide. Multiple alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LGALS9
• Uniprot:
  • O00182()