CRX/CORD2 Antibody (4G11)

Images

 
Western Blot: CRX/CORD2 Antibody (4G11) [H00001406-M02] - CRX monoclonal antibody (M02), clone 4G11 Analysis of CRX expression in IMR-32.
Western Blot: CRX/CORD2 Antibody (4G11) [H00001406-M02] - Analysis of CRX expression in transfected 293T cell line by CRX monoclonal antibody (M02), clone 4G11.Lane 1: CRX transfected lysate(32 KDa).Lane 2: ...read more
ELISA: CRX/CORD2 Antibody (4G11) [H00001406-M02] - Detection limit for recombinant GST tagged CRX is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF
Clone
4G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRX/CORD2 Antibody (4G11) Summary

Immunogen
CRX (NP_000545, 1 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
Specificity
CRX - cone-rod homeobox
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Chromatin Immunoprecipitation
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA. ChIP usage reported in scientific literature (PMID 25392503). ICC/IF usage reported in scientific literature (PMID 26563826).
Publications
Read Publications using
H00001406-M02 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25392503). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRX/CORD2 Antibody (4G11)

  • cone-rod homeobox
  • CORD2
  • CRDcone-rod homeobox protein
  • CRX
  • LCA7
  • LCA7orthodenticle homeobox 3
  • OTX3

Background

The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF2945
Species: Hu
Applications: WB
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-22568
Species: Hu
Applications: IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
NBP2-56313
Species: Hu
Applications: ICC/IF
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF

Publications for CRX/CORD2 Antibody (H00001406-M02)(15)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ChIP, ICC/IF.


Filter By Application
ChIP
(1)
ICC/IF
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species
Showing Publications 1 - 10 of 15. Show All 15 Publications.
Publications using H00001406-M02 Applications Species
Elsaeidi F, Macpherson P, Mills EA et al. Notch suppression collaborates with Ascl1 and Lin28 to unleash a regenerative response in fish retina, but not in mice. J Neurosci. 2018 Jan 29 [PMID: 29378863]
Lu AQ, Barnstable CJ. Generation of Photoreceptor Precursors from Mouse Embryonic Stem Cells. Stem Cell Reviews 2017 Oct 08 [PMID: 29047024] (ICC/IF, Mouse) ICC/IF Mouse
Sluch VM, Davis CH, Ranganathan V et al. Differentiation of human ESCs to retinal ganglion cells using a CRISPR engineered reporter cell line. Sci Rep. 2015 Nov 13 [PMID: 26563826] (ICC/IF, Human) ICC/IF Human
Khan M, Walters LL, Li Q et al. Characterization and pharmacologic targeting of EZH2, a fetal retinal protein and epigenetic regulator, in human retinoblastoma. Lab Invest. 2015 Aug 17 [PMID: 26280220]
Ohlemacher SK, Iglesias CL, Sridhar A et al. Generation of highly enriched populations of optic vesicle-like retinal cells from human pluripotent stem cells. Curr Protoc Stem Cell Biol 2015 Feb 02 [PMID: 25640818]
Reichman S, Goureau O. Production of Retinal Cells from Confluent Human iPS Cells. Methods Mol Biol 2016 [PMID: 25417064]
Xie BB, Zhang XM, Hashimoto T et al. Differentiation of retinal ganglion cells and photoreceptor precursors from mouse induced pluripotent stem cells carrying an atoh7/math5 lineage reporter. PLoS One. 2014 Nov 17 [PMID: 25401462]
Masuda T, Zhang X, Berlinicke C et al. The transcription factor GTF2IRD1 regulates the topology and function of photoreceptors by modulating photoreceptor gene expression across the retina. J Neurosci. 2014 Nov 12 [PMID: 25392503] (ChIP, Mouse) ChIP Mouse
Reichman S, Terray A, Slembrouck A et al. From confluent human iPS cells to self-forming neural retina and retinal pigmented epithelium. Proc Natl Acad Sci U S A. 2014 May 27 [PMID: 24912154]
Tran NM, Zhang A, Zhang X et al. Mechanistically Distinct Mouse Models for CRX-Associated Retinopathy. PLoS Genet. 2014 Feb 06 [PMID: 24516401]
Show All 15 Publications.

Reviews for CRX/CORD2 Antibody (H00001406-M02) (0)

There are no reviews for CRX/CORD2 Antibody (H00001406-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for CRX/CORD2 Antibody (H00001406-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CRX/CORD2 Antibody (H00001406-M02)

Discover related pathways, diseases and genes to CRX/CORD2 Antibody (H00001406-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRX/CORD2 Antibody (H00001406-M02)

Discover more about diseases related to CRX/CORD2 Antibody (H00001406-M02).
 

Pathways for CRX/CORD2 Antibody (H00001406-M02)

View related products by pathway.

PTMs for CRX/CORD2 Antibody (H00001406-M02)

Learn more about PTMs related to CRX/CORD2 Antibody (H00001406-M02).

Blogs on CRX/CORD2

There are no specific blogs for CRX/CORD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRX/CORD2 Antibody (4G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRX
Entrez
Uniprot