Galectin-4 Antibody (9Z2B5) Summary
| Description |
Novus Biologicals Rabbit Galectin-4 Antibody (9Z2B5) (NBP3-16249) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin-4 (P56470). MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAA |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
LGALS4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concenration is 1 ug/mL
- Immunocytochemistry/ Immunofluorescence 1:200 - 1:800
- Immunohistochemistry 1:100 - 1:1000
- Immunohistochemistry-Paraffin 1:100 - 1:1000
- Western Blot 1:1000 - 1:4000
|
| Theoretical MW |
36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Galectin-4 Antibody (9Z2B5)
Background
Galectins are a family of soluble beta-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. One member of this family, Galectin-4, also known as Gal-4, L36 or LGALS4 maps to human chromosome 19q13.13 and encodes a 36-37 kDa protein. The Galectin-4 protein is composed of 323 amino acids and contains two homologous carbohydrate recognition domains (CRD) and all amino acids typically conserved in the galectin family. Expression of Galectin-4 correlates with the malignant potential of human hepatocellular carcinoma (HCC) and is differentially regulated depending on cell-cell contact, serum growth factors, cell growth and cell differentiation status. Galectin-4 expression is detected in epithelial cells of the colon, rectum, intestine, and in HT29 and LS174T cell lines. Galectin-4 is underexpressed in colorectal cancer and is preferentially upregulated in cells prone to peritoneal dissemination.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Publications for Galectin-4 Antibody (NBP3-16249) (0)
There are no publications for Galectin-4 Antibody (NBP3-16249).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Galectin-4 Antibody (NBP3-16249) (0)
There are no reviews for Galectin-4 Antibody (NBP3-16249).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Galectin-4 Antibody (NBP3-16249) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Galectin-4 Products
Research Areas for Galectin-4 Antibody (NBP3-16249)
Find related products by research area.
|
Blogs on Galectin-4