GCET2 Antibody

Images

 
Western Blot: GCET2 Antibody [NBP1-82693] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: GCET2 Antibody [NBP1-82693] - Staining of human tonsil shows cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCET2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCSAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GCET2 Protein (NBP1-82693PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82693 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCET2 Antibody

  • GAL
  • GCAT2
  • germinal center B-cell-expressed transcript 2 protein
  • germinal center expressed transcript 2
  • Germinal center-associated lymphoma protein
  • HGAL
  • MGC40441

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GCET2 Antibody (NBP1-82693) (0)

There are no publications for GCET2 Antibody (NBP1-82693).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GCET2 Antibody (NBP1-82693) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82693:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GCET2 NBP1-82693
Enlarge
reviewed by:
Xiaoqing Lu
WB Human 02/04/2013
View

Summary

ApplicationWestern Blot
Sample TestedRaji whole cell lysate
SpeciesHuman
LotA01761
CommentsThe antibody worked very well, but I only tried at 1:500 dilution. Most primary antibodies can be used for western blot at 1:1000 dilution, I wish this antibody could do the same

Blocking

Blocking Details5% Milk in PBS with 0.1% Tween 20

Primary Anitbody

Dilution Ratio1:500, 4 hours room temperature, 5% Milk in PBS with 0.1% Tween 20

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG-HRP
Secondary Manufacturer Cat#Santa Cruz biotechnology, # sc-2030
Secondary Concentration1:5000

Details

Detection NotesECL+, 1 minute

Comments

CommentsThe antibody worked very well, but I only tried at 1:500 dilution. Most primary antibodies can be used for western blot at 1:1000 dilution, I wish this antibody could do the same

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCET2 Antibody (NBP1-82693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCET2 Products

Bioinformatics Tool for GCET2 Antibody (NBP1-82693)

Discover related pathways, diseases and genes to GCET2 Antibody (NBP1-82693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GCET2

There are no specific blogs for GCET2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Xiaoqing Lu
02/04/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol GCSAM