Galanin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Galanin Antibody [NBP2-33582] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining in human appendix and cerebral cortex tissues using anti-GAL antibody. Corresponding GAL RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Rhesus monkey (Macaca mulatta) gingival sections stained with anti-galanin antibody. Antibody diluted 1:1000. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human anterior pituitary gland shows strong cytoplasmic positivity in subsets of endocrine cells.
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Summary
Reactivity Hu, MkSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Galanin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Specificity
Specificity of human, monkey Galanin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Galanin Protein (NBP2-33582PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-33582 in the following applications:

Publications
Read Publication using NBP2-33582.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Galanin Antibody

  • GAL
  • GAL1
  • galanin prepropeptide
  • Galanin
  • GALN
  • GALNgalanin-related peptide
  • GLNNgalanin-message-associated peptide
  • GMAP
  • MGC40167

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
MAB4077
Species: Hu
Applications: WB, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
H00008706-P01
Species: Hu
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P

Publications for Galanin Antibody (NBP2-33582)(1)

We have publications tested in 1 confirmed species: Monkey.


Filter By Application
All Applications
Filter By Species
Monkey
(1)
All Species

Review for Galanin Antibody (NBP2-33582) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Macaca mulatta.

Reviews using NBP2-33582:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Macaca mulatta
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Galanin NBP2-33582
Enlarge
reviewed by:
Anonymous
IHC-P Macaca mulatta 02/13/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedrhesus monkey gingival epithelium
SpeciesMacaca mulatta
LotR59739

Comments

CommentsHIER = Diva Decloaker (pressure cooker)
Antibody Dilution = 1:1000
Incubation = 4°C overnight
Chromogen = DAB

Reference code NSCS16

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Galanin Antibody (NBP2-33582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Galanin Antibody (NBP2-33582)

Discover related pathways, diseases and genes to Galanin Antibody (NBP2-33582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galanin Antibody (NBP2-33582)

Discover more about diseases related to Galanin Antibody (NBP2-33582).
 

Pathways for Galanin Antibody (NBP2-33582)

View related products by pathway.

PTMs for Galanin Antibody (NBP2-33582)

Learn more about PTMs related to Galanin Antibody (NBP2-33582).
 

Research Areas for Galanin Antibody (NBP2-33582)

Find related products by research area.

Blogs on Galanin

There are no specific blogs for Galanin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
02/13/2017
Application: IHC-P
Species: Macaca mulatta

Bioinformatics

Gene Symbol GAL
Entrez
Uniprot