FoxC1 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2). AAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FOXC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:100-1:1000
|
| Theoretical MW |
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FoxC1 Antibody - BSA Free
Background
FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ELISA
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Publications for FoxC1 Antibody (NBP3-05017) (0)
There are no publications for FoxC1 Antibody (NBP3-05017).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FoxC1 Antibody (NBP3-05017) (0)
There are no reviews for FoxC1 Antibody (NBP3-05017).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FoxC1 Antibody (NBP3-05017) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FoxC1 Products
Research Areas for FoxC1 Antibody (NBP3-05017)
Find related products by research area.
|
Blogs on FoxC1