FoxC1 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining in human salivary gland and liver tissues using anti-FOXC1 antibody. Corresponding FOXC1 RNA-seq data are presented for more
Immunocytochemistry/ Immunofluorescence: FoxC1 Antibody [NBP1-89025] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: FoxC1 Antibody [NBP1-89025] - Mouse embryonic brain section was stained with anti-FOXC1 antibody.Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining of human salivary gland shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, IP
Validated by:

Orthogonal Strategies


Order Details

FoxC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Specificity of human FoxC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
Application Notes
IP reported in scientific literature (PMID: 24840332). FoxC1 antibody validated for ICC/IF from a verified customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FoxC1 Protein (NBP1-89025PEP)
Reviewed Applications
Read 1 Review rated 3
NBP1-89025 in the following applications:

Read Publication using NBP1-89025.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24840332).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FoxC1 Antibody

  • ARA
  • FKHL7
  • forkhead box C1
  • forkhead box protein C1
  • forkhead, drosophila, homolog-like 7
  • forkhead/winged helix-like transcription factor 7
  • forkhead-related activator 3
  • Forkhead-related protein FKHL7
  • Forkhead-related transcription factor 3
  • FoxC1
  • FREAC3
  • FREAC-3
  • IGDA
  • IHG1
  • IRID1
  • myeloid factor-delta
  • RIEG3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P, In vitro
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for FoxC1 Antibody (NBP1-89025)(1)

We have publications tested in 1 application: IP.

Filter By Application
All Applications
Filter By Species
All Species

Review for FoxC1 Antibody (NBP1-89025) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-89025:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence FoxC1 NBP1-89025
reviewed by:
Li Wang
IF Mouse 10/05/2014


Sample TestedMouse embryo
CommentsIt seems that the staining is weaker if you block the slides using goat serum.

Primary Anitbody

Dilution Ratio1:50


Fixation DetailsSlide is fixed in 4% PFA and permeabilized in 0.1% Triton X-100 in 1x PBS


CommentsIt seems that the staining is weaker if you block the slides using goat serum.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FoxC1 Antibody (NBP1-89025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FoxC1 Products

Bioinformatics Tool for FoxC1 Antibody (NBP1-89025)

Discover related pathways, diseases and genes to FoxC1 Antibody (NBP1-89025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC1 Antibody (NBP1-89025)

Discover more about diseases related to FoxC1 Antibody (NBP1-89025).

Pathways for FoxC1 Antibody (NBP1-89025)

View related products by pathway.

PTMs for FoxC1 Antibody (NBP1-89025)

Learn more about PTMs related to FoxC1 Antibody (NBP1-89025).

Research Areas for FoxC1 Antibody (NBP1-89025)

Find related products by research area.

Blogs on FoxC1

There are no specific blogs for FoxC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Li Wang
Application: IF
Species: Mouse


Gene Symbol FOXC1