FoxC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FoxC1 Antibody [NBP1-89025] - Mouse embryonic brain section was stained with anti-FOXC1 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining of human testis shows moderate nuclear positivity in spermatogonia of seminiferous ducts and moderate cytoplasmic in spermatids.
Immunocytochemistry/ Immunofluorescence: FoxC1 Antibody [NBP1-89025] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FoxC1 Protein (NBP1-89025PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-89025 in the following applications:

Publications
Read Publication using NBP1-89025.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24840332)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxC1 Antibody

  • ARA
  • FKHL7
  • FKHL7RIEG3
  • forkhead box C1
  • forkhead box protein C1
  • forkhead, drosophila, homolog-like 7
  • forkhead/winged helix-like transcription factor 7
  • forkhead-related activator 3
  • Forkhead-related protein FKHL7
  • Forkhead-related transcription factor 3
  • FoxC1
  • FREAC3
  • FREAC-3
  • FREAC3IRID1
  • IGDA
  • IHG1
  • IRID1
  • myeloid factor-delta
  • RIEG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FoxC1 Antibody (NBP1-89025)(1)

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
All Species

Review for FoxC1 Antibody (NBP1-89025) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IF.

Reviews using NBP1-89025:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence FoxC1 NBP1-89025
Enlarge
reviewed by:
Li Wang
IF Mouse 10/05/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse embryo
SpeciesMouse
CommentsIt seems that the staining is weaker if you block the slides using goat serum.

Primary Anitbody

Dilution Ratio1:50

Details

Fixation DetailsSlide is fixed in 4% PFA and permeabilized in 0.1% Triton X-100 in 1x PBS

Comments

CommentsIt seems that the staining is weaker if you block the slides using goat serum.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FoxC1 Antibody (NBP1-89025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxC1 Products

Bioinformatics Tool for FoxC1 Antibody (NBP1-89025)

Discover related pathways, diseases and genes to FoxC1 Antibody (NBP1-89025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC1 Antibody (NBP1-89025)

Discover more about diseases related to FoxC1 Antibody (NBP1-89025).
 

Pathways for FoxC1 Antibody (NBP1-89025)

View related products by pathway.

PTMs for FoxC1 Antibody (NBP1-89025)

Learn more about PTMs related to FoxC1 Antibody (NBP1-89025).
 

Research Areas for FoxC1 Antibody (NBP1-89025)

Find related products by research area.

Blogs on FoxC1

There are no specific blogs for FoxC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Li Wang
10/05/2014
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol FOXC1
Entrez