FoxC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining in human salivary gland and liver tissues using anti-FOXC1 antibody. Corresponding FOXC1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: FoxC1 Antibody [NBP1-89025] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: FoxC1 Antibody [NBP1-89025] - Mouse embryonic brain section was stained with anti-FOXC1 antibody.Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: FoxC1 Antibody [NBP1-89025] - Staining of human salivary gland shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FoxC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FoxC1 Antibody - BSA Free (NBP1-89025) is a polyclonal antibody validated for use in IHC, ICC/IF and IP. Anti-FoxC1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation Reported in scientific literature (PMID: 24840332)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FoxC1 Protein (NBP1-89025PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FoxC1 Antibody - BSA Free

• ARA
• FKHL7
• FKHL7RIEG3
• forkhead box C1
• forkhead box protein C1
• forkhead, drosophila, homolog-like 7
• forkhead/winged helix-like transcription factor 7
• forkhead-related activator 3
• Forkhead-related protein FKHL7
• Forkhead-related transcription factor 3
• FoxC1
• FREAC3
• FREAC-3
• FREAC3IRID1
• IGDA
• IHG1
• IRID1
• myeloid factor-delta
• RIEG3

Background

FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FoxC1 Antibody (NBP1-89025)(1)

Publication using NBP1-89025

• DeGraff DJ, Grabowska MM, Case T et al. Foxa1 deletion in luminal epithelium causes prostatic hyperplasia and alteration of differentiated phenotype. Lab Invest 2014-07-01 [PMID: 24840332] (IP)

Review for FoxC1 Antibody (NBP1-89025) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Li Wang IF Mouse 10/05/2014

Summary

• Application: Immunofluorescence
• Sample Tested: Mouse embryo
• Species: Mouse

Bioinformatics

• Gene Symbol: FOXC1