FGFR4 Antibody - BSA Free

Immunohistochemistry-Paraffin: FGFR4 Antibody [NBP1-84586] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGFR4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGFR4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  FGFR4 Recombinant Protein Antigen (NBP1-84586PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FGFR4 Antibody - BSA Free

• CD334 antigen
• CD334
• EC 2.7.10
• EC 2.7.10.1
• FGF R4
• FGFR4
• FGFR-4
• fibroblast growth factor receptor 4
• JTK2hydroxyaryl-protein kinase
• MGC20292
• protein-tyrosine kinase
• TKF
• tyrosine kinase related to fibroblast growth factor receptor
• tyrosylprotein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGFR4