FDX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining in human adrenal gland and cerebral cortex tissues using anti-FDX1 antibody. Corresponding FDX1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human adrenal gland, cerebral cortex, colon and lymph node using Anti-FDX1 antibody NBP2-38946 (A) shows similar protein distribution across tissues to independent antibody NBP1-89227 (B).

Immunocytochemistry/Immunofluorescence: FDX1 Antibody [NBP2-38946] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human lymph node.

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human colon.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FDX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FDX1 Antibody - BSA Free (NBP2-38946) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-FDX1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FDX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FDX1 Protein (NBP2-38946PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FDX1 Antibody - BSA Free

• Adrenal ferredoxin
• adrenodoxin, mitochondrial
• ADXhepatoredoxin
• FDX
• ferredoxin 1
• Ferredoxin-1
• Hepatoredoxin
• LOH11CR1D
• mitochondrial adrenodoxin

Background

The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FDX1 Antibody (NBP2-38946)(1)

Publication using NBP2-38946

• Sakata Y, Cheng K, Mayama M et al. Reconstitution of human adrenocortical specification and steroidogenesis using induced pluripotent stem cells Developmental cell 2022-11-21 [PMID: 36413950]

Bioinformatics

• Gene Symbol: FDX1
• Uniprot:
  • P10109(Human)