Cortistatin Antibody


Western Blot: Cortistatin Antibody [NBP1-69148] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA

Order Details

Cortistatin Antibody Summary

Synthetic peptides corresponding to CORT (cortistatin) The peptide sequence was selected from the N terminal of CORT. Peptide sequence MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFL. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CORT and was validated on Western blot. Use in ELISA reported in scientific literature (PMID: 30181699).
Theoretical MW
2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-69148 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30181699).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cortistatin Antibody

  • cortistatin
  • cortistatin-14
  • cortistatin-17
  • cortistatin-29
  • CST-14
  • CST-17
  • CST-29
  • MGC32686
  • preprocortistatin


This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. However, it also has many properties distinct from somatostatin, such as induction of slow-wave sleep, apparently by antagonism of the excitatory effects of acetylcholine on the cortex, reduction of locomotor activity, and activation of cation selective currents not responsive to somatostatin. The preproprotein undergoes further processing into multiple mature products. Read-through transcripts exist between this gene and the upstream APITD1 (apoptosis-inducing, TAF9-like domain 1) gene, as represented in GeneID:100526739.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA

Publications for Cortistatin Antibody (NBP1-69148)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: ELISA.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Cortistatin Antibody (NBP1-69148) (0)

There are no reviews for Cortistatin Antibody (NBP1-69148). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cortistatin Antibody (NBP1-69148) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Cortistatin Products

Bioinformatics Tool for Cortistatin Antibody (NBP1-69148)

Discover related pathways, diseases and genes to Cortistatin Antibody (NBP1-69148). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cortistatin Antibody (NBP1-69148)

Discover more about diseases related to Cortistatin Antibody (NBP1-69148).

Pathways for Cortistatin Antibody (NBP1-69148)

View related products by pathway.

PTMs for Cortistatin Antibody (NBP1-69148)

Learn more about PTMs related to Cortistatin Antibody (NBP1-69148).

Research Areas for Cortistatin Antibody (NBP1-69148)

Find related products by research area.

Blogs on Cortistatin

There are no specific blogs for Cortistatin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cortistatin Antibody and receive a gift card or discount.


Gene Symbol CORT