Fc gamma RIIA/CD32a Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FCGR2A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Fc gamma RIIA/CD32a Antibody - BSA Free
Background
The FCGR2A gene encodes a low affinity immunoglobulin gamma Fc region receptor II-a protein that in isoform 1 is 317 amino acids long at 35 kDA and at isoform 2 is 316 amino acids long at nearly 35 kDA. These proteins are found on the surface of many immune system response cells that act as a low affinity receptor through encouraging responses against pathogens and soluble antigens. Additionally, it functions to initiate phagocytosis of opsonized antigens. FCGR2A participates in Fc-GammaR pathway, osteoclast differentiation, signaling events controlled by PTP1B, and NFAT in immune response. It is known to interact with genes SYK, FYN, HCK, LGALS3, and PIK3R1. FCGR2A is linked to lupus, thrombocytopenia, b-cell lymphomas, otitis media, adult-onset still's disease, guillain-barre syndrome, asymptomatic dengue, severe acute respiratory syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind
Species: Hu
Applications: Bind
Species: Hu
Applications: BA
Species: Hu
Applications: Bind
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: Bind
Species: Hu
Applications: ICC/IF
Publications for Fc gamma RIIA/CD32a Antibody (NBP3-21229) (0)
There are no publications for Fc gamma RIIA/CD32a Antibody (NBP3-21229).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fc gamma RIIA/CD32a Antibody (NBP3-21229) (0)
There are no reviews for Fc gamma RIIA/CD32a Antibody (NBP3-21229).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fc gamma RIIA/CD32a Antibody (NBP3-21229). (Showing 1 - 1 of 1 FAQ).
-
Does any of your FCGR2A antibodies (19C10, 6D11, 13G9) cross react to FCGR2B?
- For these antibodies, we have used the full-length protein FCGR2A (NP_067674) as the immunogen and we have not mapped the epitope that is detected with each Ab yet. I did an alignment of these two proteins and they are highly conserved thus it seems likely that there will be cross-reactivity.
Secondary Antibodies
| |
Isotype Controls
|
Additional Fc gamma RIIA/CD32a Products
Research Areas for Fc gamma RIIA/CD32a Antibody (NBP3-21229)
Find related products by research area.
|
Blogs on Fc gamma RIIA/CD32a