Fc gamma RIIA/CD32a Antibody


Western Blot: Fc gamma RIIA/CD32a Antibody [NBP1-84589] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Fc gamma RIIA/CD32a Antibody [NBP1-84589] - Staining in human placenta and skeletal muscle tissues using anti-FCGR2A antibody. Corresponding FCGR2A RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Fc gamma RIIA/CD32a Antibody [NBP1-84589] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.
Immunohistochemistry-Paraffin: Fc gamma RIIA/CD32a Antibody [NBP1-84589] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: Fc gamma RIIA/CD32a Antibody [NBP1-84589] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Fc gamma RIIA/CD32a Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Specificity of human Fc gamma RIIA/CD32a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fc gamma RIIA/CD32a Protein (NBP1-84589PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Fc gamma RIIA/CD32a Antibody

  • CD32 antigen
  • CD32a
  • CD32MGC23887
  • CDw32fc-gamma-RIIa
  • Fc fragment of IgG, low affinity IIa, receptor (CD32)
  • Fc fragment of IgG, low affinity IIa, receptor for (CD32)
  • Fc gamma RIIA
  • FCG2
  • Fc-gamma RII-a
  • Fc-gamma-RIIa
  • FcGR
  • FCGR2
  • FCGR2A
  • FCGR2A1
  • FcgRIIA
  • fcRII-a
  • IGFR2MGC30032
  • IgG Fc receptor II-a
  • Immunoglobulin G Fc receptor II
  • low affinity immunoglobulin gamma Fc region receptor II-a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: Flow, IHC-Fr, IP, B/N
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
Species: Hu
Species: Mu
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for Fc gamma RIIA/CD32a Antibody (NBP1-84589) (0)

There are no publications for Fc gamma RIIA/CD32a Antibody (NBP1-84589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc gamma RIIA/CD32a Antibody (NBP1-84589) (0)

There are no reviews for Fc gamma RIIA/CD32a Antibody (NBP1-84589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fc gamma RIIA/CD32a Antibody (NBP1-84589). (Showing 1 - 1 of 1 FAQ).

  1. Does any of your FCGR2A antibodies (19C10, 6D11, 13G9) cross react to FCGR2B?
    • For these antibodies, we have used the full-length protein FCGR2A (NP_067674) as the immunogen and we have not mapped the epitope that is detected with each Ab yet. I did an alignment of these two proteins and they are highly conserved thus it seems likely that there will be cross-reactivity.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Fc gamma RIIA/CD32a Antibody (NBP1-84589)

Discover related pathways, diseases and genes to Fc gamma RIIA/CD32a Antibody (NBP1-84589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc gamma RIIA/CD32a Antibody (NBP1-84589)

Discover more about diseases related to Fc gamma RIIA/CD32a Antibody (NBP1-84589).

Pathways for Fc gamma RIIA/CD32a Antibody (NBP1-84589)

View related products by pathway.

PTMs for Fc gamma RIIA/CD32a Antibody (NBP1-84589)

Learn more about PTMs related to Fc gamma RIIA/CD32a Antibody (NBP1-84589).

Blogs on Fc gamma RIIA/CD32a

There are no specific blogs for Fc gamma RIIA/CD32a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fc gamma RIIA/CD32a Antibody and receive a gift card or discount.


Gene Symbol FCGR2A