FAM20C Antibody

Images

 
Western Blot: FAM20C Antibody [NBP1-70768] - NTERA2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM20C Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM20C(family with sequence similarity 20, member C) The peptide sequence was selected from the C terminal of FAM20C. Peptide sequence NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM20C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAM20C and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM20C Antibody

  • dentin matrix protein 4
  • DKFZp547C074
  • DMP4
  • DMP-4
  • FAM20C
  • family with sequence similarity 20, member C
  • GEF-CK
  • RNS

Background

FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP2-13881
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for FAM20C Antibody (NBP1-70768) (0)

There are no publications for FAM20C Antibody (NBP1-70768).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM20C Antibody (NBP1-70768) (0)

There are no reviews for FAM20C Antibody (NBP1-70768). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM20C Antibody (NBP1-70768) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM20C Products

Bioinformatics Tool for FAM20C Antibody (NBP1-70768)

Discover related pathways, diseases and genes to FAM20C Antibody (NBP1-70768). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM20C Antibody (NBP1-70768)

Discover more about diseases related to FAM20C Antibody (NBP1-70768).
 

Pathways for FAM20C Antibody (NBP1-70768)

View related products by pathway.

PTMs for FAM20C Antibody (NBP1-70768)

Learn more about PTMs related to FAM20C Antibody (NBP1-70768).

Blogs on FAM20C

There are no specific blogs for FAM20C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM20C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM20C
Entrez