Cystatin F Antibody

Images

 
Western Blot: Cystatin F Antibody [NBP2-13881] - Analysis in control (vector only transfected HEK293T lysate) and cST7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human pancreas shows strong cytoplasmic positivity in pancreatic ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cystatin F Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVP WLQHFEVPVLRCH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CST7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cystatin F Protein (NBP2-13881PEP)
Reviewed Applications
Read 2 Reviews rated 3.5
using
NBP2-13881 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cystatin F Antibody

  • CMAP
  • CST7
  • Cystatin 7
  • cystatin F (leukocystatin)
  • Cystatin F
  • Cystatin-7
  • cystatin-F
  • Cystatin-like metastasis-associated protein
  • Leukocystatin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
AF6108
Species: Hu
Applications: IHC
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF745
Species: Mu
Applications: WB, Block
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cystatin F Antibody (NBP2-13881) (0)

There are no publications for Cystatin F Antibody (NBP2-13881).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin F Antibody (NBP2-13881) (2) 3.52

Average Rating: 3.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 2 application: WB, IF.

Reviews using NBP2-13881:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Cystatin F NBP2-13881
Enlarge
reviewed by:
Anonymous
WB Human 08/10/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK and NK92 whole cell lysates
SpeciesHuman

Blocking

Blocking Details5%milk/PBS, pH 7.4, 1h, room temperature

Primary Anitbody

Dilution Ratiodilution 1:600, 5%milk/PBS, pH 7.4, overnight, 4°C

Secondary Antibody

Secondary Descriptiongoat anti-rabbit IgG, HRP
Secondary Concentration1:5000 dilution in 5%milk/PBS, pH 7.4

Details

Detection NotesECL, exposure 1h

Comments

CommentsNice bands for cystatin F dimeric and monomeric form in NK92 cell lysates, no non-specific staining in HEK293 cell lysates (do not express cystatin F).
Immunofluorescence Cystatin F NBP2-13881
Enlarge
reviewed by:
Anonymous
IF Human 08/10/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedHEK293 and NK92 cell lines
SpeciesHuman

Blocking

Blocking Details3% bovine serum albumin in PBS, pH 7.4, for 1h

Primary Anitbody

Dilution Ratiodilution 1:10 in 1% bovine serum albumin in PBS, pH 7.4, incubation 1h at room temperature

Secondary Antibody

Secondary Descriptiondonkey anti-rabbit Alexa 488
Secondary Manufacturer Cat#A-21206
Secondary Concentration1:1000 dilution in PBS

Details

Detection Notesconfocal LSM710 microscope from Carl Zeiss
Fixation Detailsfixation with 4% paraformaldehyde for 20 min and permeabilization by 0.2% Triton-X in PBS, pH 7.4, for 10 min
Wash Description3 times for 5 minutes in PBS, pH 7.4

Comments

CommentsThe antibody NBP2-13881 stained nicely NK92 cells and cystatin F transfected HEK293 cells, however it also stained non-transfected HEK293 that do not express cystatin F. Antigen retreival methods were not tested.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin F Antibody (NBP2-13881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin F Products

Bioinformatics Tool for Cystatin F Antibody (NBP2-13881)

Discover related pathways, diseases and genes to Cystatin F Antibody (NBP2-13881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin F Antibody (NBP2-13881)

Discover more about diseases related to Cystatin F Antibody (NBP2-13881).
 

Pathways for Cystatin F Antibody (NBP2-13881)

View related products by pathway.

PTMs for Cystatin F Antibody (NBP2-13881)

Learn more about PTMs related to Cystatin F Antibody (NBP2-13881).

Blogs on Cystatin F

There are no specific blogs for Cystatin F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3.5
5
1
4
0
3
0
2
1
1
0

Anonymous
08/10/2015
Application: WB
Species: Human

Anonymous
08/10/2015
Application: IF
Species: Human

Bioinformatics

Gene Symbol CST7
Entrez