Cystatin F Antibody


Western Blot: Cystatin F Antibody [NBP2-13881] - Analysis in control (vector only transfected HEK293T lysate) and cST7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining in human bone marrow and cerebral cortex tissues using anti-CST7 antibody. Corresponding CST7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human pancreas shows strong cytoplasmic positivity in pancreatic ducts.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Cystatin F Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVP WLQHFEVPVLRCH
Specificity of human Cystatin F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cystatin F Protein (NBP2-13881PEP)
Reviewed Applications
Read 2 Reviews rated 3.5
NBP2-13881 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cystatin F Antibody

  • CMAP
  • CST7
  • Cystatin 7
  • cystatin F (leukocystatin)
  • Cystatin F
  • Cystatin-7
  • cystatin-F
  • Cystatin-like metastasis-associated protein
  • Leukocystatin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Block
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cystatin F Antibody (NBP2-13881) (0)

There are no publications for Cystatin F Antibody (NBP2-13881).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin F Antibody (NBP2-13881) (2) 3.52

Average Rating: 3.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP2-13881:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Cystatin F NBP2-13881
reviewed by:
WB Human 08/10/2015


ApplicationWestern Blot
Sample TestedHEK and NK92 whole cell lysates


Blocking Details5%milk/PBS, pH 7.4, 1h, room temperature

Primary Anitbody

Dilution Ratiodilution 1:600, 5%milk/PBS, pH 7.4, overnight, 4°C

Secondary Antibody

Secondary Descriptiongoat anti-rabbit IgG, HRP
Secondary Concentration1:5000 dilution in 5%milk/PBS, pH 7.4


Detection NotesECL, exposure 1h


CommentsNice bands for cystatin F dimeric and monomeric form in NK92 cell lysates, no non-specific staining in HEK293 cell lysates (do not express cystatin F).
Immunofluorescence Cystatin F NBP2-13881
reviewed by:
IF Human 08/10/2015


Sample TestedHEK293 and NK92 cell lines


Blocking Details3% bovine serum albumin in PBS, pH 7.4, for 1h

Primary Anitbody

Dilution Ratiodilution 1:10 in 1% bovine serum albumin in PBS, pH 7.4, incubation 1h at room temperature

Secondary Antibody

Secondary Descriptiondonkey anti-rabbit Alexa 488
Secondary Manufacturer Cat#A-21206
Secondary Concentration1:1000 dilution in PBS


Detection Notesconfocal LSM710 microscope from Carl Zeiss
Fixation Detailsfixation with 4% paraformaldehyde for 20 min and permeabilization by 0.2% Triton-X in PBS, pH 7.4, for 10 min
Wash Description3 times for 5 minutes in PBS, pH 7.4


CommentsThe antibody NBP2-13881 stained nicely NK92 cells and cystatin F transfected HEK293 cells, however it also stained non-transfected HEK293 that do not express cystatin F. Antigen retreival methods were not tested.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin F Antibody (NBP2-13881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cystatin F Products

Bioinformatics Tool for Cystatin F Antibody (NBP2-13881)

Discover related pathways, diseases and genes to Cystatin F Antibody (NBP2-13881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin F Antibody (NBP2-13881)

Discover more about diseases related to Cystatin F Antibody (NBP2-13881).

Pathways for Cystatin F Antibody (NBP2-13881)

View related products by pathway.

PTMs for Cystatin F Antibody (NBP2-13881)

Learn more about PTMs related to Cystatin F Antibody (NBP2-13881).

Blogs on Cystatin F

There are no specific blogs for Cystatin F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human

Application: IF
Species: Human


Gene Symbol CST7