HIP-55 Antibody

Images

 
Independent Antibodies: Western Blot: HIP-55 Antibody [NBP1-91988] - Analysis using Anti-DBNL antibody NBP1-91988 (A) shows similar pattern to independent antibody NBP1-91989 (B).
Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human testis.
Western Blot: HIP-55 Antibody [NBP1-91988] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human lymph node shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining in human lymph node and liver tissues using anti-DBNL antibody. Corresponding DBNL RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-DBNL antibody NBP1-91988 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIP-55 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
Specificity
Specificity of human, mouse, rat HIP-55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBNL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HIP-55 Protein (NBP1-91988PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIP-55 Antibody

  • ABP1
  • Cervical SH3P7
  • CMAP
  • drebrin-F
  • drebrin-like protein
  • drebrin-like
  • HIP-55SH3P7Cervical mucin-associated protein
  • HPK1-interacting protein of 55 kDa
  • SH3 domain-containing protein 7
  • src homology 3 domain-containing protein HIP-55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-78736
Species: Hu
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-72961
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB9521
Species: Hu, Mu
Applications: WB, IHC, IP
NB100-1045
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM, IP
AF1444
Species: Mu
Applications: WB, IHC
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB39102
Species: Hu
Applications: ICC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for HIP-55 Antibody (NBP1-91988) (0)

There are no publications for HIP-55 Antibody (NBP1-91988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIP-55 Antibody (NBP1-91988) (0)

There are no reviews for HIP-55 Antibody (NBP1-91988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIP-55 Antibody (NBP1-91988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HIP-55 Products

Bioinformatics Tool for HIP-55 Antibody (NBP1-91988)

Discover related pathways, diseases and genes to HIP-55 Antibody (NBP1-91988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIP-55 Antibody (NBP1-91988)

Discover more about diseases related to HIP-55 Antibody (NBP1-91988).
 

Pathways for HIP-55 Antibody (NBP1-91988)

View related products by pathway.

PTMs for HIP-55 Antibody (NBP1-91988)

Learn more about PTMs related to HIP-55 Antibody (NBP1-91988).
 

Research Areas for HIP-55 Antibody (NBP1-91988)

Find related products by research area.

Blogs on HIP-55

There are no specific blogs for HIP-55, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIP-55 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBNL