FAM20C Antibody


Western Blot: FAM20C Antibody [NBP1-70767] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FAM20C Antibody Summary

Synthetic peptides corresponding to FAM20C(family with sequence similarity 20, member C) The peptide sequence was selected from the middle region of FAM20C. Peptide sequence CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAM20C and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM20C Antibody

  • dentin matrix protein 4
  • DKFZp547C074
  • DMP4
  • DMP-4
  • FAM20C
  • family with sequence similarity 20, member C
  • GEF-CK
  • RNS


FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Bv
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for FAM20C Antibody (NBP1-70767) (0)

There are no publications for FAM20C Antibody (NBP1-70767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM20C Antibody (NBP1-70767) (0)

There are no reviews for FAM20C Antibody (NBP1-70767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM20C Antibody (NBP1-70767). (Showing 1 - 1 of 1 FAQ).

  1. Does this product recognize murine fam20c? I see a blot against HepG2 lysate which is human. Do you have similar data for mouse? Either mouse cell lines or transfected mouse DNA?
    • The immunogen for this antibody shares 100% similarity with mouse so it should cross-react. This is why we have mouse listed on our datasheet.

Secondary Antibodies


Isotype Controls

Additional FAM20C Products

Bioinformatics Tool for FAM20C Antibody (NBP1-70767)

Discover related pathways, diseases and genes to FAM20C Antibody (NBP1-70767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM20C Antibody (NBP1-70767)

Discover more about diseases related to FAM20C Antibody (NBP1-70767).

Pathways for FAM20C Antibody (NBP1-70767)

View related products by pathway.

PTMs for FAM20C Antibody (NBP1-70767)

Learn more about PTMs related to FAM20C Antibody (NBP1-70767).

Blogs on FAM20C

There are no specific blogs for FAM20C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM20C Antibody and receive a gift card or discount.


Gene Symbol FAM20C