ESRP2 Antibody

Images

 
Immunohistochemistry-Paraffin: ESRP2 Antibody [NBP2-13972] - Staining of human stomach, upper shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ESRP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EFHMQHPSTCPARDLTVATMAQGLGLETDATEDDFGVWEVKTMVAVILHL LKEPSSQLFSKPEVIKQKYETGPCSKADVVDSETVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ESRP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ESRP2 Protein (NBP2-13972PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13972 in the following applications:

Publications
Read Publication using
NBP2-13972 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%). Human reactivity reported in scientific literature (PMID: 26522722).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ESRP2 Antibody

  • epithelial splicing regulatory protein 2
  • FLJ21918
  • FLJ22248
  • RBM35BRNA-binding protein 35B
  • RNA binding motif protein 35A
  • RNA binding motif protein 35B
  • RNA-binding motif protein 35B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82201
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ESRP2 Antibody (NBP2-13972)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for ESRP2 Antibody (NBP2-13972) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP2-13972:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin ESRP2 NBP2-13972
Enlarge
reviewed by:
Mei Deng
IHC-P Human and Mouse 02/24/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedEmbryonic lung,Adult intestine
SpeciesHuman and Mouse

Comments

Commentsgood immunoperoxidase staining of IHC-P on human and mouse tissue with this antibody at a dilution 1:500. The section was pre-treated by heat mediated antigen retrieval with sodium citrate buffer (pH6).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ESRP2 Antibody (NBP2-13972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ESRP2 Products

Bioinformatics Tool for ESRP2 Antibody (NBP2-13972)

Discover related pathways, diseases and genes to ESRP2 Antibody (NBP2-13972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESRP2 Antibody (NBP2-13972)

Discover more about diseases related to ESRP2 Antibody (NBP2-13972).
 

Pathways for ESRP2 Antibody (NBP2-13972)

View related products by pathway.

Blogs on ESRP2

There are no specific blogs for ESRP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Mei Deng
02/24/2017
Application: IHC-P
Species: Human and Mouse

Bioinformatics

Gene Symbol ESRP2