RP2 Antibody (1B4)

Images

 
Western Blot: RP2 Antibody (1B4) [H00006102-M01] - RP2 monoclonal antibody (M01), clone 1B4. Analysis of RP2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: RP2 Antibody (1B4) [H00006102-M01] - Analysis of monoclonal antibody to RP2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: RP2 Antibody (1B4) [H00006102-M01] - Detection limit for recombinant GST tagged RP2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RP2 Antibody (1B4) Summary

Immunogen
RP2 (NP_008846, 251 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Specificity
RP2 - retinitis pigmentosa 2 (X-linked recessive) (1B4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RP2 Antibody (1B4)

  • DELXp11.3
  • KIAA0215
  • NME10
  • protein XRP2
  • retinitis pigmentosa 2 (X-linked recessive)
  • TBCCD2
  • XRP2

Background

The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-80698
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46542
Species: Hu
Applications: WB, IHC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
AF755
Species: Mu
Applications: WB, Block
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for RP2 Antibody (H00006102-M01) (0)

There are no publications for RP2 Antibody (H00006102-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RP2 Antibody (H00006102-M01) (0)

There are no reviews for RP2 Antibody (H00006102-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RP2 Antibody (H00006102-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RP2 Products

Bioinformatics Tool for RP2 Antibody (H00006102-M01)

Discover related pathways, diseases and genes to RP2 Antibody (H00006102-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RP2 Antibody (H00006102-M01)

Discover more about diseases related to RP2 Antibody (H00006102-M01).
 

Pathways for RP2 Antibody (H00006102-M01)

View related products by pathway.

PTMs for RP2 Antibody (H00006102-M01)

Learn more about PTMs related to RP2 Antibody (H00006102-M01).
 

Research Areas for RP2 Antibody (H00006102-M01)

Find related products by research area.

Blogs on RP2

There are no specific blogs for RP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RP2 Antibody (1B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RP2
Entrez
Uniprot