ERAS Antibody - BSA Free

Western Blot: ERAS Antibody [NBP1-79602] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ERAS Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human ErasThe immunogen for this antibody is Eras. Peptide sequence LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERAS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ERAS Antibody - BSA Free

• Embryonic stem cell-expressed Ras
• E-Ras
• ES cell expressed Ras
• HRAS2MGC126693
• HRASPGTPase ERas
• MGC126691
• small GTPase protein E-Ras
• v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2
• v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene

Background

ERAS belongs to the small GTPase superfamily. Ras family. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. The ERas gene is expressed in embryonic stem (ES) cells and promotes their in vitro proliferation and tumorigenicity. ERas-null ES cells maintain pluripotency but show significantly reduced growth and tumorigenicity, which are rescued by expression of ERas complementary DNA or by activated phosphatidylinositol-3-OH kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERAS
• Uniprot:
  • NP_853526(Mouse)