GTP binding protein era homolog Antibody

Images

 
Independent Antibodies: Western Blot: GTP binding protein era homolog Antibody [NBP1-89704] - Analysis using Anti-ERAL1 antibody NBP1-89704 (A) shows similar pattern to independent antibody NBP1-89703 (B).
Immunocytochemistry/ Immunofluorescence: GTP binding protein era homolog Antibody [NBP1-89704] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: GTP binding protein era homolog Antibody [NBP1-89704] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

GTP binding protein era homolog Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTP binding protein era homolog Protein (NBP1-89704PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTP binding protein era homolog Antibody

  • CEGA
  • Conserved ERA-like GTPase
  • Era (E. coli G-protein homolog)-like 1
  • Era G-protein-like 1 (E. coli)
  • ERA
  • ERAL1A
  • ERA-like protein 1
  • ERA-W
  • GTPase Era, mitochondrial
  • GTPase, human homolog of E. coli essential cell cycle protein Era
  • GTP-binding protein era homolog
  • hERA
  • H-ERA
  • HERA-A
  • HERA-B

Background

ERAL1( AAH19094, 1 a.a. - 438 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
7570-GH
Species: Hu
Applications: EnzAct
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
QET00B
Species: Hu
Applications: ELISA
DCRP00
Species: Hu
Applications: ELISA
NBP1-89704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GTP binding protein era homolog Antibody (NBP1-89704) (0)

There are no publications for GTP binding protein era homolog Antibody (NBP1-89704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTP binding protein era homolog Antibody (NBP1-89704) (0)

There are no reviews for GTP binding protein era homolog Antibody (NBP1-89704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTP binding protein era homolog Antibody (NBP1-89704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTP binding protein era homolog Products

Bioinformatics Tool for GTP binding protein era homolog Antibody (NBP1-89704)

Discover related pathways, diseases and genes to GTP binding protein era homolog Antibody (NBP1-89704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTP binding protein era homolog Antibody (NBP1-89704)

Discover more about diseases related to GTP binding protein era homolog Antibody (NBP1-89704).
 

Pathways for GTP binding protein era homolog Antibody (NBP1-89704)

View related products by pathway.

Blogs on GTP binding protein era homolog

There are no specific blogs for GTP binding protein era homolog, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTP binding protein era homolog Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERAL1