Endoglin/CD105 Antibody - BSA Free

Immunohistochemistry-Paraffin: Endoglin/CD105 Antibody [NBP2-49516] - Analysis in human placenta and pancreas tissues. Corresponding ENG RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Endoglin/CD105 Antibody [NBP2-49516] - Staining of human testis shows moderate membranous positivity in peritubular myoid cells.

Immunohistochemistry: Endoglin/CD105 Antibody [NBP2-49516] - Staining of human placenta shows membranous positivity in trophoblasts.

Immunohistochemistry-Paraffin: Endoglin/CD105 Antibody [NBP2-49516] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Endoglin/CD105 Antibody [NBP2-49516] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Endoglin/CD105 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Endoglin/CD105 Antibody - BSA Free (NBP2-49516) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ENG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Endoglin/CD105 Recombinant Protein Antigen (NBP2-49516PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Endoglin/CD105 Antibody - BSA Free

• CD105 antigen
• CD105
• Endoglin
• ENDOsler-Rendu-Weber syndrome 1
• ENG
• HHT1FLJ41744
• ORW
• ORW1

Background

CD105 is a 90 kD homodimeric type I integral membrane glycoprotein, also known as endoglin. It is expressed on endothelial cells (especially on angiogenic endothelial cells) and up-regulated by hypoxia, activated monocytes, macrophages, bone marrow stromal cells, and some cytotrophoblasts. CD105 is a receptor for TGF- szlig1, TGF- szlig3 and modulates TGF- szlig signaling by interacting with TGF- szlig receptors I and/or II. CD105 also binds other growth factors such as actvin A, BMP-2 and -7. CD105 has been show to be a useful marker for identifying proliferating endothelium involved in tumor angiogenesis and can be used for tumor imaging, prognosis, as well as has therapeutic potential for some solid tumors and other angiogenic diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Endoglin/CD105 Antibody (NBP2-49516). (Showing 1 - 2 of 2 FAQ).

1. I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?
   • We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.
2. We are interested in CD105 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
   • We do not currently carry any CD105 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD105 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Bioinformatics

• Gene Symbol: ENG