ECT2L Antibody


Immunocytochemistry/ Immunofluorescence: ECT2L Antibody [NBP1-90847] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: ECT2L Antibody [NBP1-90847] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ECT2L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ
Specificity of human ECT2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ECT2L Protein (NBP1-90847PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ECT2L Antibody

  • ARHGEF32
  • dJ509I19.2
  • dJ509I19.3
  • epithelial cell transforming sequence 2 oncogene-like
  • LFDH
  • lung-specific F-box and DH domain-containing protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Ca
Applications: B/N, Flow, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ECT2L Antibody (NBP1-90847) (0)

There are no publications for ECT2L Antibody (NBP1-90847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECT2L Antibody (NBP1-90847) (0)

There are no reviews for ECT2L Antibody (NBP1-90847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ECT2L Antibody (NBP1-90847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ECT2L Products

ECT2L NBP1-90847

Bioinformatics Tool for ECT2L Antibody (NBP1-90847)

Discover related pathways, diseases and genes to ECT2L Antibody (NBP1-90847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECT2L Antibody (NBP1-90847)

Discover more about diseases related to ECT2L Antibody (NBP1-90847).

Blogs on ECT2L

There are no specific blogs for ECT2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ECT2L Antibody and receive a gift card or discount.


Gene Symbol ECT2L