Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody - BSA Free (NBP3-17013) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKE |
| Predicted Species |
Mouse (97%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DDAH1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody - BSA Free
Background
DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: CyTOF-ready, Flow, Func, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
Publications for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP3-17013) (0)
There are no publications for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP3-17013).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP3-17013) (0)
There are no reviews for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP3-17013).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP3-17013) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Products
Research Areas for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP3-17013)
Find related products by research area.
|
Blogs on Dimethylarginine Dimethylaminohydrolase 1/DDAH1