Dectin-1/CLEC7A Antibody


Western Blot: Dectin-1/CLEC7A Antibody [NBP2-55630] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: Dectin-1/CLEC7A Antibody [NBP2-55630] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

Dectin-1/CLEC7A Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS
Specificity of human Dectin-1/CLEC7A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dectin-1/CLEC7A Recombinant Protein Antigen (NBP2-55630PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Dectin-1/CLEC7A Antibody

  • Beta-glucan receptor
  • BGR
  • CD369
  • CLEC7A
  • CLECSF12
  • CLECSF12DC-associated C-type lectin 1
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 12
  • C-type lectin domain family 7 member A
  • C-type lectin domain family 7, member A
  • C-type lectin superfamily member 12
  • Dectin1
  • Dectin-1
  • Dendritic cell-associated C-type lectin 1
  • dendritic cell-associated C-type lectin-1
  • hDectin-1
  • lectin-like receptor 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ce, ChHa, Pm, RM
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Dual ISH-IHC, Single-Cell Western

Publications for Dectin-1/CLEC7A Antibody (NBP2-55630) (0)

There are no publications for Dectin-1/CLEC7A Antibody (NBP2-55630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dectin-1/CLEC7A Antibody (NBP2-55630) (0)

There are no reviews for Dectin-1/CLEC7A Antibody (NBP2-55630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dectin-1/CLEC7A Antibody (NBP2-55630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Dectin-1/CLEC7A Products

Bioinformatics Tool for Dectin-1/CLEC7A Antibody (NBP2-55630)

Discover related pathways, diseases and genes to Dectin-1/CLEC7A Antibody (NBP2-55630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dectin-1/CLEC7A Antibody (NBP2-55630)

Discover more about diseases related to Dectin-1/CLEC7A Antibody (NBP2-55630).

Pathways for Dectin-1/CLEC7A Antibody (NBP2-55630)

View related products by pathway.

Research Areas for Dectin-1/CLEC7A Antibody (NBP2-55630)

Find related products by research area.

Blogs on Dectin-1/CLEC7A

There are no specific blogs for Dectin-1/CLEC7A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Dectin-1/CLEC7A Antibody and receive a gift card or discount.


Gene Symbol CLEC7A