CARD9 Antibody

Images

 
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human spleen shows weak to moderate cytoplasmic positivity in a subset of leukocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Analysis in human spleen and cerebral cortex tissues. Corresponding CARD9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human tonsil shows moderate cytoplasmic positivity in a subset of leukocytes.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CARD9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GSPKQPFAALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS
Specificity
Specificity of human CARD9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CARD9 Protein (NBP2-37975PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CARD9 Antibody

  • CANDF2
  • CARD9
  • caspase recruitment domain family, member 9
  • caspase recruitment domain-containing protein 9
  • hCARD9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1859
Species: Hu
Applications: Flow, Block, CyTOF-ready, ICC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF4839
Species: Hu, Mu, Rt
Applications: WB
NBP2-22471
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NB100-56722
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NBP2-29430
Species: Hu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27159
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
NBP2-27327
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO

Publications for CARD9 Antibody (NBP2-37975) (0)

There are no publications for CARD9 Antibody (NBP2-37975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CARD9 Antibody (NBP2-37975) (0)

There are no reviews for CARD9 Antibody (NBP2-37975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CARD9 Antibody (NBP2-37975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CARD9 Products

Bioinformatics Tool for CARD9 Antibody (NBP2-37975)

Discover related pathways, diseases and genes to CARD9 Antibody (NBP2-37975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CARD9 Antibody (NBP2-37975)

Discover more about diseases related to CARD9 Antibody (NBP2-37975).
 

Pathways for CARD9 Antibody (NBP2-37975)

View related products by pathway.

PTMs for CARD9 Antibody (NBP2-37975)

Learn more about PTMs related to CARD9 Antibody (NBP2-37975).

Blogs on CARD9

There are no specific blogs for CARD9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CARD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD9
Uniprot