![Western Blot: DAK Antibody [NBP2-48894] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue](http://images.novusbio.com/fullsize2/DAK-Antibody-Western-Blot-NBP2-48894-img0002.jpg "Western Blot: DAK Antibody [NBP2-48894] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL |
| Specificity | Specificity of human DAK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (91%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for DAK Antibody (NBP2-48894)Discover more about diseases related to DAK Antibody (NBP2-48894).
| Pathways for DAK Antibody (NBP2-48894)View related products by pathway.
|
PTMs for DAK Antibody (NBP2-48894)Learn more about PTMs related to DAK Antibody (NBP2-48894).
| Research Areas for DAK Antibody (NBP2-48894)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAK |
![Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human liver.](http://images.novusbio.com/fullsize2/DAK-Antibody-Immunohistochemistry-Paraffin-NBP2-48894-img0007.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human liver.")
![Immunohistochemistry: DAK Antibody [NBP2-48894] - Staining of human small intestine shows cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/DAK-Antibody-Immunohistochemistry-NBP2-48894-img0001.jpg "Immunohistochemistry: DAK Antibody [NBP2-48894] - Staining of human small intestine shows cytoplasmic and nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human duodenum shows high expression.](http://images.novusbio.com/fullsize2/DAK-Antibody-Immunohistochemistry-Paraffin-NBP2-48894-img0003.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human duodenum shows high expression.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize2/DAK-Antibody-Immunohistochemistry-Paraffin-NBP2-48894-img0004.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining in human duodenum and skeletal muscle tissues using anti-TKFC antibody. Corresponding TKFC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/DAK-Antibody-Immunohistochemistry-Paraffin-NBP2-48894-img0005.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining in human duodenum and skeletal muscle tissues using anti-TKFC antibody. Corresponding TKFC RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human duodenum, kidney, liver and skeletal muscle using Anti-TKFC antibody NBP2-48894 (A) shows similar protein distribution across tissues to independent antibody NBP1-84142 (B).](http://images.novusbio.com/fullsize2/DAK-Antibody-Immunohistochemistry-Paraffin-NBP2-48894-img0006.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human duodenum, kidney, liver and skeletal muscle using Anti-TKFC antibody NBP2-48894 (A) shows similar protein distribution across tissues to independent antibody NBP1-84142 (B).")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human kidney.](http://images.novusbio.com/fullsize2/DAK Antibody-Immunohistochemistry-Paraffin-NBP2-48894-img0008.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human kidney.")
![Western Blot: Ext2 Antibody [NBP1-58297] - Human Hela, Antibody Dilution: 1.0 ug/ml EXT2 is supported by BioGPS gene expression data to be expressed in HeLa.](http://images.novusbio.com/images2/Ext2-Antibody-Western-Blot-NBP1-58297-img0003.jpg)
![Immunohistochemistry: Ext2 Antibody [NBP1-58297] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://images.novusbio.com/images2/Ext2-Antibody-Immunohistochemistry-NBP1-58297-img0004.jpg)
![Western Blot: Ext2 Antibody [NBP1-58297] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/Ext2-Antibody-Western-Blot-NBP1-58297-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Glypican 4 Antibody [NBP1-87697] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/Glypican-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87697-img0005.jpg)
![Immunohistochemistry-Paraffin: Glypican 4 Antibody [NBP1-87697] - Staining of human tonsil shows negative positivity in non-germinal center cells as expected.](http://images.novusbio.com/images2/Glypican-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87697-img0009.jpg)
![Immunohistochemistry-Paraffin: Glypican 4 Antibody [NBP1-87697] - Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.](http://images.novusbio.com/images2/Glypican-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87697-img0006.jpg)
![Western Blot: PP14/Glycodelin Antibody [NBP1-89781] - Analysis in human placenta tissue.](http://images.novusbio.com/images2/PP14-Glycodelin-Antibody-Western-Blot-NBP1-89781-img0014.jpg)
![Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/images2/PP14-Glycodelin-Antibody-Immunohistochemistry-Paraffin-NBP1-89781-img0019.jpg)
![Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining of human endometrium shows high expression.](http://images.novusbio.com/images2/PP14-Glycodelin-Antibody-Immunohistochemistry-Paraffin-NBP1-89781-img0006.jpg)
![Western Blot: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/images2/Prolyl-Oligopeptidase-PREP-Antibody-Western-Blot-NBP2-33950-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody stainin is shown in green.](http://images.novusbio.com/images2/Prolyl-Oligopeptidase-PREP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33950-img0005.jpg)
![Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining in human colon and pancreas tissues using anti-PREP antibody. Corresponding PREP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Prolyl-Oligopeptidase-PREP-Antibody-Immunohistochemistry-Paraffin-NBP2-33950-img0008.jpg)
![Western Blot: PTS Antibody [NBP1-32975] - Wild-type (WT) and PTS knockout (KO) HeLa cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with PTS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.](http://images.novusbio.com/images2/PTS-Antibody-Western-Blot-NBP1-32975-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: PTS Antibody [NBP1-32975] - Analysis of methanol-fixed HeLa, using antibody at 1:100 dilution.](http://images.novusbio.com/images2/PTS Antibody-Immunocytochemistry-Immunofluorescence-NBP1-32975-img0002.jpg)
![Immunohistochemistry-Paraffin: PTS Antibody [NBP1-32975] - Paraffin-embedded Hepatoma, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/PTS Antibody-Immunohistochemistry-Paraffin-NBP1-32975-img0003.jpg)
![Western Blot: SLC35B2 Antibody [NBP2-83546] - WB Suggested Anti-SLC35B2 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell](http://images.novusbio.com/images2/SLC35B2 Antibody-Western Blot-NBP2-83546-img0001.jpg)
![SDS-Page: Recombinant Human AGA Protein [NBP2-52631]](http://images.novusbio.com/images2/AGA-Recombinant-Protein-SDS-Page-NBP2-52631-img0001.jpg)
![Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/LMW-Kininogen-Antibody-Western-Blot-NBP1-89993-img0009.jpg)
![Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.](http://images.novusbio.com/images2/LMW Kininogen Antibody-Immunohistochemistry-Paraffin-NBP1-89993-img0014.jpg)
![Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/LMW-Kininogen-Antibody-Western-Blot-NBP1-89993-img0003.jpg)
![Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of rat whole brain lysates using mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain. Strong bands at 40, 45kDa correspond to DCX protein, detected only in the developing brain.](http://images.novusbio.com/images2/Doublecortin-Antibody-(3E1)-Western-Blot-NBP1-92684-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of cortical neuron-glial cell culture from E20 rat stained with mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in red, and costained with chicken pAb to Microtubule Associated Protein2 (MAP2), dilution 1:10,000 in green. The blue is DAPI staining of nuclear DNA. DCX antibody reveals strong cytoplasmic staining in a population of small developing neurons and their processes, while MAP2 antibody stains dendrites and perikarya of mature neurons. Therefore DCX antibody is an excellent marker of developing neuronal cells.](http://images.novusbio.com/images2/Doublecortin-Antibody-(3E1)-Immunocytochemistry-Immunofluorescence-NBP1-92684-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.](http://images.novusbio.com/images2/Doublecortin-Antibody-(3E1)-Immunocytochemistry-Immunofluorescence-NBP1-92684-img0003.jpg)
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0015.jpg)
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows similar protein distribution across tissues to independent antibody NBP1-87442 (B).](http://images.novusbio.com/images2/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0028.jpg)
![Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/images2/Transketolase-Antibody-Western-Blot-NBP1-87441-img0018.jpg)
![Western Blot: Glycerol kinase Antibody [NBP1-57033] - U937 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/Glycerol kinase Antibody-Western Blot-NBP1-57033-img0002.jpg)
![Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/images2/RHD-Antibody-Western-Blot-NBP2-84247-img0004.jpg)
![Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226](http://images.novusbio.com/images2/RHD-Antibody-Western-Blot-NBP2-84247-img0001.jpg)
![Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells](http://images.novusbio.com/images2/RHD-Antibody-Western-Blot-NBP2-84247-img0002.jpg)
![Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).](http://images.novusbio.com/images2/Sorbitol-Dehydrogenase-Antibody-Western-Blot-NBP1-87416-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Sorbitol-Dehydrogenase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87416-img0005.jpg)
![Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/images2/Sorbitol-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-87416-img0020.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")