DAK Antibody

Images

 
Western Blot: DAK Antibody [NBP2-48894] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue
Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human liver.
Immunohistochemistry: DAK Antibody [NBP2-48894] - Staining of human small intestine shows cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining in human duodenum and skeletal muscle tissues using anti-TKFC antibody. Corresponding TKFC RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human duodenum, kidney, liver and skeletal muscle using Anti-TKFC antibody NBP2-48894 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: DAK Antibody [NBP2-48894] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DAK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL
Specificity
Specificity of human DAK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAK Recombinant Protein Antigen (NBP2-48894PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DAK Antibody

  • ATP-dependent dihydroxyacetone kinase
  • bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
  • DHA kinase
  • Dha kinase/FMN cyclase
  • dihydroxyacetone kinase 2 homolog (S. cerevisiae)
  • dihydroxyacetone kinase 2 homolog (yeast)
  • DKFZP586B1621
  • FAD-AMP lyase cyclic FMN forming
  • FAD-AMP lyase cyclizing
  • glycerone kinase
  • MGC5621
  • NET45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58297
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87697
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-83546
Species: Hu
Applications: WB
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-57033
Species: Hu
Applications: WB
NB100-65887
Species: Hu
Applications: Flow, IP
NBP2-84247
Species: Hu
Applications: WB
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DAK Antibody (NBP2-48894) (0)

There are no publications for DAK Antibody (NBP2-48894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAK Antibody (NBP2-48894) (0)

There are no reviews for DAK Antibody (NBP2-48894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAK Antibody (NBP2-48894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DAK Products

Bioinformatics Tool for DAK Antibody (NBP2-48894)

Discover related pathways, diseases and genes to DAK Antibody (NBP2-48894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAK Antibody (NBP2-48894)

Discover more about diseases related to DAK Antibody (NBP2-48894).
 

Pathways for DAK Antibody (NBP2-48894)

View related products by pathway.

PTMs for DAK Antibody (NBP2-48894)

Learn more about PTMs related to DAK Antibody (NBP2-48894).
 

Research Areas for DAK Antibody (NBP2-48894)

Find related products by research area.

Blogs on DAK

There are no specific blogs for DAK, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAK