Glycerol Kinase Antibody (8S4T8)

Images

 
Western Blot: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Western blot analysis of extracts of various cell lines, using Glycerol Kinase (GK) antibody (NBP3-15687) at 1:1000 dilution. Secondary antibody: HRP Goat ...read more
Immunohistochemistry-Paraffin: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Immunohistochemistry of paraffin-embedded mouse testis using Glycerol Kinase Rabbit mAb (NBP3-15687) at dilution of 1:100 (40x lens).Perform ...read more
Western Blot: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Western blot analysis of extracts of various cell lines, using Glycerol Kinase (GK) antibody (NBP3-15687) at 1:1000 dilution. Secondary antibody: HRP Goat ...read more
Immunohistochemistry-Paraffin: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Immunohistochemistry of paraffin-embedded rat kidney using Glycerol Kinase Rabbit mAb (NBP3-15687) at dilution of 1:100 (40x lens).Perform ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clone
8S4T8
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glycerol Kinase Antibody (8S4T8) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol Kinase (P32189). IPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
GK
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Glycerol Kinase Antibody (8S4T8)

  • ATP:glycerol 3-phosphotransferase
  • EC 2.7.1.30
  • GK
  • GK1
  • GKD
  • glpK
  • Glycerokinase
  • Glycerol Kinase

Background

Glycerol kinase catalyzes the formation of glycerol 3 phosphate from ATP and glycerol. Dihydroxyacetone and L glyceraldehyde can also act as acceptors; UTP and, in the case of the yeast enzyme, ITP and GTP can act as donors. It provides a way for glycerol derived from fats or glycerides to enter the glycolytic pathway. NB - Glycerol kinase obtained from Cellulomonas spp has an observed molecular weight of 128kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glycerol Kinase Antibody (NBP3-15687) (0)

There are no publications for Glycerol Kinase Antibody (NBP3-15687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycerol Kinase Antibody (NBP3-15687) (0)

There are no reviews for Glycerol Kinase Antibody (NBP3-15687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycerol Kinase Antibody (NBP3-15687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycerol Kinase Products

Research Areas for Glycerol Kinase Antibody (NBP3-15687)

Find related products by research area.

Blogs on Glycerol Kinase

There are no specific blogs for Glycerol Kinase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycerol Kinase Antibody (8S4T8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GK