Home » Transketolase » Transketolase Research Products » Transketolase Antibody

Transketolase Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows ...read more
Orthogonal Strategies: Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading ...read more
Genetic Strategies: Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TKT antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image submitted by a verified customer review.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human cerebral cortex using Anti-TKT antibody.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human testis using Anti-TKT antibody.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow using Anti-TKT antibody NBP1-87441.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87441.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Transketolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
Specificity
Specificity of human Transketolase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TKT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Transketolase antibody validated for WB from a verified customer review.
Control Peptide
Transketolase Protein (NBP1-87441PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87441 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transketolase Antibody

  • EC 2.2.1.1
  • FLJ34765
  • TK
  • TKT1
  • transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(8 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
Thymidylate
Synthase Antibody (SP
NBP2-34390
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on Hek293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Transaldolase 1
Antibody
NBP1-88109
Western Blot: Transaldolase 1 Antibody [NBP1-88109] - Analysis in human cell line HepG2.
Immunocytochemistry/Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Western Blot: Transaldolase 1 Antibody [NBP1-88109] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Glutathione
Reductase Antibody
NBP2-16684
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione Reductase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Glutathione Reductase Antibody [NBP2-16684] - Paraffin-embedded rat brain. Glutathione reductase antibody [N2C2], Internal diluted at 1:500.
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Sample (30 ug of whole cell lysate) A: HCT116 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
HPRT Antibody
NBP1-33527
Western Blot: HPRT Antibody [NBP1-33527] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: HPRT Antibody [NBP1-33527] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-33527] - Paraffin-embedded rat colon. HPRT antibody diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PRRT2 Antibody
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(458 Publications)
Species: Hu
Cav1.2 Antibody
NBP2-76914
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody [NBP2-76914] - ICC staining CACNA1C in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Cav1.2 Antibody [NBP2-76914] - Immunohistochemical analysis of paraffin-embedded mouse heart tissue using anti-CACNA1C antibody. Counter stained with hematoxylin.
Flow Cytometry: Cav1.2 Antibody [NBP2-76914] - Flow cytometric analysis of SKOV-3 cells with CACNA1C antibody at 1/100 dilution (fuchsia) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
Thromboxane
synthase Antibody (OT
NBP2-02710
Western Blot: Thromboxane synthase Antibody (2C1) [NBP2-02710] Analysis of extracts (35ug) from 9 different cell lines by using anti-Thromboxane synthase monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Thromboxane synthase.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of paraffin-embedded Human liver tissue using anti-Thromboxane synthase mouse monoclonal antibody.
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Kallikrein 1
Antibody (323803) [Un ...
MAB2337
Kallikrein 1 Antibody (323803) [Unconjugated]
(1 Review)
Species: Hu
Applications: WB, IP
PGD Antibody
(OTI2A5)
NBP2-45880
Western Blot: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PGD.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human thyroid tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Species: Hu
Applications: WB, IHC, IHC-P, IF
Thymidine Kinase 1
Antibody
NBP2-20626
Western Blot: Thymidine Kinase 1 Antibody [NBP2-20626] - Wild-type (WT) and Thymidine Kinase 1 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Thymidine Kinase 1 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
Immunohistochemistry-Paraffin: Thymidine Kinase 1 Antibody [NBP2-20626] - Thymidine Kinase 1 antibody detects Thymidine Kinase 1 protein at cytoplasm by immunohistochemical analysis. Sample: Paraffin-embedded rat ovary. Thymidine Kinase 1 stained by Thymidine Kinase 1 antibody diluted at 1:500.
Western Blot: Thymidine Kinase 1 Antibody [NBP2-20626] - A431 whole cell and cytoplasm extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Thymidine Kinase 1 antibody diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Transketolase
Antibody
NBP1-87441
Transketolase Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Transketolase Antibody (NBP1-87441) (0)

There are no publications for Transketolase Antibody (NBP1-87441).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Transketolase Antibody (NBP1-87441) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-87441:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Anonymous
 WB Other 09/03/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T cells lysate
SpeciesOther
LotN/A
CommentsTransketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:2000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Descriptionanti-rabbit IgG HRP conjugate (Jackson Labs)
Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20:000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 5 sec exposure

Comments

CommentsTransketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transketolase Antibody (NBP1-87441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Transketolase Products

Bioinformatics Tool for Transketolase Antibody (NBP1-87441)

Discover related pathways, diseases and genes to Transketolase Antibody (NBP1-87441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transketolase Antibody (NBP1-87441)

Discover more about diseases related to Transketolase Antibody (NBP1-87441).
 

Pathways for Transketolase Antibody (NBP1-87441)

View related products by pathway.

PTMs for Transketolase Antibody (NBP1-87441)

Learn more about PTMs related to Transketolase Antibody (NBP1-87441).
 

Research Areas for Transketolase Antibody (NBP1-87441)

Find related products by research area.

Blogs on Transketolase

There are no specific blogs for Transketolase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
 
 Anonymous
09/03/2014
Application: WB
Species: Other
read this review

Bioinformatics

Gene Symbol TKT