Transketolase Antibody (NBP1-87441)

Images

 
Western Blot: Transketolase Antibody [NBP1-87441] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows strongnuclear positivity in hematopoietic cells.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image from verified customer review.
Western Blot: Transketolase Antibody [NBP1-87441] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transketolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TKT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
Transketolase Protein (NBP1-87441PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87441 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transketolase Antibody

  • EC 2.2.1.1
  • FLJ34765
  • TK
  • TKT1
  • transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-236
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37245
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Transketolase Antibody (NBP1-87441) (0)

There are no publications for Transketolase Antibody (NBP1-87441).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Transketolase Antibody (NBP1-87441) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-87441:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Transketolase NBP1-87441
Enlarge
reviewed by:
Anonymous
WB Human 09/03/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T cells lysate
SpeciesHuman
CommentsTransketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:2000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Descriptionanti-rabbit IgG HRP conjugate (Jackson Labs)
Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20:000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 5 sec exposure

Comments

CommentsTransketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transketolase Antibody (NBP1-87441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transketolase Products

Related Products by Gene

Bioinformatics Tool for Transketolase Antibody (NBP1-87441)

Discover related pathways, diseases and genes to Transketolase Antibody (NBP1-87441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transketolase Antibody (NBP1-87441)

Discover more about diseases related to Transketolase Antibody (NBP1-87441).
 

Pathways for Transketolase Antibody (NBP1-87441)

View related products by pathway.

PTMs for Transketolase Antibody (NBP1-87441)

Learn more about PTMs related to Transketolase Antibody (NBP1-87441).
 

Research Areas for Transketolase Antibody (NBP1-87441)

Find related products by research area.

Blogs on Transketolase

There are no specific blogs for Transketolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/03/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol TKT