Home » Transketolase » Transketolase Antibodies » Transketolase Antibody

Transketolase Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows ...read more
Orthogonal Strategies: Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading ...read more
Genetic Strategies: Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TKT antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image submitted by a verified customer review.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human cerebral cortex using Anti-TKT antibody.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human testis using Anti-TKT antibody.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow using Anti-TKT antibody NBP1-87441.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87441.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Transketolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TKT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Transketolase antibody validated for WB from a verified customer review.
Control Peptide
Transketolase Protein (NBP1-87441PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87441 in the following applications:
Publications
Read Publication using
NBP1-87441 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transketolase Antibody

  • EC 2.2.1.1
  • FLJ34765
  • TK
  • TKT1
  • transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Thymidylate
Synthase Antibody (SP
NBP2-34390
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human testicular carcinoma stained with Thymidylate Synthase Mouse Monoclonal Antibody (SPM453).
(1 Review)
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
Transaldolase 1 His P ...
NBP1-45316
Western Blot: Transaldolase 1 Protein [NBP1-45316] - 15% SDS-PAGE (3ug)
(1 Review)
(1 Publication)
Species: Hu
Applications: PAGE
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Substance P was detected in immersion fixed paraffin-embedded sections of human spinal cord using 8 µg/mL Human/Mouse/Rat Substance P Monoclonal Antibody (Catalog # MAB4375) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the spinal cord dorsal horn. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC
Glutathione
Reductase Antibody
NBP2-76932
Western Blot: Glutathione Reductase Antibody [NBP2-76932] - Western blot analysis of GLUR on different lysates using anti-GLUR antibody at 1/2,000 dilution.Positive control:Lane1: A549 Lane2: Rat liver tissue
Immunocytochemistry/Immunofluorescence: Glutathione Reductase Antibody [NBP2-76932] - ICC staining GLUR in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Glutathione Reductase Antibody [NBP2-76932] - Immunohistochemical analysis of paraffin-embedded rat epididymis tissue using anti-GLUR antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HPRT Antibody
NBP1-33527
Western Blot: HPRT Antibody [NBP1-33527] - Wild-type (WT) and HPRT knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HPRT Antibody [NBP1-33527] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-33527] - Paraffin-embedded human endometrial cancer. HPRT antibody) diluted at 1:500.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(27 Reviews)
(613 Publications)
Species: Hu
Applications: BA
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody (S57) [NBP1-22439] - Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Cav1.2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cell Membrane, Membrane, Cytoplasm, Nucleoplasm. Magnification: 60X. (A) Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain.
Western Blot: Cav1.2 Antibody (S57) [NBP1-22439] - Western Blot analysis of Hamster T-CHO cell lysate showing detection of CaV1.2 Calcium Channel protein using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57 (NBP1-22439). Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody (NBP1-22439) at 1:1000.
Immunohistochemistry: Cav1.2 Antibody (S57) [NBP1-22439] - Immunohistochemistry analysis using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57 (NBP1-22439). Tissue: hippocampus. Species: Human. Fixation: 10% formalin. Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody (NBP1-22439) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Analysis of Hela cells, using anti-Thromboxane synthase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Analysis of Jurkat cells, using anti-Thromboxane synthase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Thromboxane synthase antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Kallikrein 1
Antibody (323803) [Un ...
MAB2337
Kallikrein 1 Antibody (323803) [Unconjugated]
(1 Review)
Species: Hu
Applications: IP, WB
PGD Antibody
(OTI2A5)
NBP2-45880
Immunofluorescence: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY PGD.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Carcinoma of Human prostate tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
Thymidine Kinase 1
Antibody
NBP2-20626
Immunohistochemistry-Paraffin: Thymidine Kinase 1 Antibody [NBP2-20626] - Thymidine Kinase 1 antibody detects Thymidine Kinase 1 protein at cytoplasm by immunohistochemical analysis. Sample: Paraffin-embedded rat ovary. Thymidine Kinase 1 stained by Thymidine Kinase 1 antibody diluted at 1:500.
Western Blot: Thymidine Kinase 1 Antibody [NBP2-20626] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Thymidine Kinase 1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: Thymidine Kinase 1 Antibody [NBP2-20626] - Wild-type (WT) and Thymidine Kinase 1 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Thymidine Kinase 1 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Transketolase
Antibody
NBP1-87441
Transketolase Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Transketolase Antibody (NBP1-87441)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for Transketolase Antibody (NBP1-87441) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-87441:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Anatoli Grechov
 Western Blot Other 09/03/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T cells lysate
SpeciesOther
LotN/A

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transketolase Antibody (NBP1-87441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transketolase Products

Bioinformatics Tool for Transketolase Antibody (NBP1-87441)

Discover related pathways, diseases and genes to Transketolase Antibody (NBP1-87441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transketolase Antibody (NBP1-87441)

Discover more about diseases related to Transketolase Antibody (NBP1-87441).
 

Pathways for Transketolase Antibody (NBP1-87441)

View related products by pathway.

PTMs for Transketolase Antibody (NBP1-87441)

Learn more about PTMs related to Transketolase Antibody (NBP1-87441).
 

Research Areas for Transketolase Antibody (NBP1-87441)

Find related products by research area.

Blogs on Transketolase

There are no specific blogs for Transketolase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
 
 Anatoli Grechov
09/03/2014
Application: Western Blot
Species: Other
read this review

Bioinformatics

Gene Symbol TKT