Transketolase Antibody

Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-TKT antibody. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.

Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image from verified customer review.

Western Blot: Transketolase Antibody [NBP1-87441] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Transketolase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
• Specificity: Specificity of human, mouse, rat Transketolase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TKT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Transketolase Protein (NBP1-87441PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transketolase Antibody

• EC 2.2.1.1
• FLJ34765
• TK
• TKT1
• transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Transketolase Antibody (NBP1-87441) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Anonymous WB Human 09/03/2014

Summary

• Application: Western Blot
• Sample Tested: 293T cells lysate
• Species: Human
• Comments: Transketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Blocking

• Blocking Details: 5% BSA in PBS

Primary Anitbody

• Dilution Ratio: 1:2000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

• Secondary Description: anti-rabbit IgG HRP conjugate (Jackson Labs)
• Secondary Manufacturer Cat#: 111-005-045
• Secondary Concentration: 1:20:000

Details

• Detection Notes: Probed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 5 sec exposure

Comments

• Comments: Transketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Bioinformatics

• Gene Symbol: TKT