Transketolase Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows ...read more
Orthogonal Strategies: Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading ...read more
Genetic Strategies: Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TKT antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image submitted by a verified customer review.
Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human cerebral cortex using Anti-TKT antibody.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human testis using Anti-TKT antibody.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow using Anti-TKT antibody NBP1-87441.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87441.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transketolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
Specificity
Specificity of human Transketolase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TKT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Transketolase antibody validated for WB from a verified customer review.
Control Peptide
Transketolase Protein (NBP1-87441PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87441 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transketolase Antibody

  • EC 2.2.1.1
  • FLJ34765
  • TK
  • TKT1
  • transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-88109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP2-45880
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Transketolase Antibody (NBP1-87441) (0)

There are no publications for Transketolase Antibody (NBP1-87441).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Transketolase Antibody (NBP1-87441) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-87441:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Anonymous
WB Other 09/03/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T cells lysate
SpeciesOther
LotN/A
CommentsTransketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:2000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Descriptionanti-rabbit IgG HRP conjugate (Jackson Labs)
Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20:000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 5 sec exposure

Comments

CommentsTransketolase is a very good loading control for relatively higher molecular weight and this antibody works very well for that.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transketolase Antibody (NBP1-87441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Transketolase Products

Bioinformatics Tool for Transketolase Antibody (NBP1-87441)

Discover related pathways, diseases and genes to Transketolase Antibody (NBP1-87441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transketolase Antibody (NBP1-87441)

Discover more about diseases related to Transketolase Antibody (NBP1-87441).
 

Pathways for Transketolase Antibody (NBP1-87441)

View related products by pathway.

PTMs for Transketolase Antibody (NBP1-87441)

Learn more about PTMs related to Transketolase Antibody (NBP1-87441).
 

Research Areas for Transketolase Antibody (NBP1-87441)

Find related products by research area.

Blogs on Transketolase

There are no specific blogs for Transketolase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
09/03/2014
Application: WB
Species: Other

Bioinformatics

Gene Symbol TKT