Transketolase Antibody

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows similar protein distribution across tissues to independent antibody NBP1-87442 (B).

Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TKT antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.

Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image submitted by a verified customer review.

Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human cerebral cortex using Anti-TKT antibody.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human testis using Anti-TKT antibody.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow using Anti-TKT antibody NBP1-87441.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87441.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Transketolase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TKT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Transketolase antibody validated for WB from a verified customer review.
• Control Peptide:

  Transketolase Protein (NBP1-87441PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transketolase Antibody

• EC 2.2.1.1
• FLJ34765
• TK
• TKT1
• transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transketolase Antibody (NBP1-87441)(2)

Publications using NBP1-87441

• Chen Y, Zhang T, Zeng S et al. Transketolase in human Muller cells is critical to resist light stress through the pentose phosphate and NRF2 pathways Redox Biology 2022-08-01 [PMID: 35779441] (WB, IF/IHC, Human)
• Scaffa A, Yao H, Oulhen N Et al. Single-cell transcriptomics reveals lasting changes in the lung cellular landscape into adulthood after neonatal hyperoxic exposure Redox biology 2021-08-16 [PMID: 34417156] (IF/IHC, Human)

Review for Transketolase Antibody (NBP1-87441) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Anatoli Grechov WB Other 09/03/2014

Summary

• Application: Western Blot
• Sample Tested: 293T cells lysate
• Species: Other
• Lot: N/A

Bioinformatics

• Gene Symbol: TKT